Search

A controlled experiment was conducted to investigate the effect of salinity and alkalinity stresses on the growth and physiological characteristics of Carum copticum L. The treatments included four salinity levels: 0, 50, 100 and 150 mM NaCl, and four alkalinity levels 0, 20, 40 and 60 mM NaHCO

Caraway, a well-known traditional Uyghur medicine, has been used to treat vitiligo for centuries. Its biological effects on melanin synthesis of caraway have been investigated. However, beyond psoralen and isopsoralen alone, no further chemical component of caraway has been revealed. In this study, ultra-high performance liquid chromatography coupled with hybrid quadrupole orbitrap mass spectrometry was employed to comprehensively characterize the chemical components present in caraway. Based on accurate mass measurements, key fragmental ions and comparison with reference standards, 75 chemical components were identified in caraway. Moreover, a tandem mass spectrometry method was developed and validated for quantitative analysis of three pairs isomeric components, namely psoralen/isopsoralen, bavachin/isobavachalcone and bavachromene/isobavachromene in rat plasma. Psoralen, isopsoralen, bavachin, and isobavachalcone showed linearity with concentration ranging of 1.0-500.0 ng/ml. The linear ranges for bavachromene and isobavachromene were 0.2-500.0 ng/ml. The accuracies were in ranges of 85%-115% with coefficient of variation errors of less than 15%. Furthermore, the method was applied to quantify the three pairs isomeric components in rats after oral administration of caraway.

Agricultural intensification has led to structurally simplified landscapes with reduced and fragmented resources for farmland insects. However, studies on the effects of landscape composition on farmland insects have mainly been performed in areas dominated by open arable land and semi-natural grasslands, while studies from forest-dominated landscapes are scarce. This research examined the effects of landscape composition on hoverfly species richness and abundance in arable land in boreal forest-dominated landscapes. Hoverflies were sampled in 22 mass-flowering caraway (Carum carvi) fields in Central Finland using pan traps. The effects of landscape composition on species richness and abundance were examined for all hoverflies, and for species groups with different adult habitat preferences. Landscape composition was measured as proportions of land cover classes within two different radii. Species richness and abundances of all hoverflies, forest species and open-habitat species increased with decreasing arable land cover and/or increasing forest cover within a 500 m radius (the two land cover classes strongly negatively correlated). Wetland species were most abundant in landscapes with an intermediate cover of arable land and forest, and most species-rich in landscapes with intermediate (10%) water cover. The species richness and abundance of mixed-habitat species increased with increasing cover of transitional woodland. Implications for insect conservation Our results show that most hoverfies in arable land benefit from increasing surrounding forest cover even in relatively heterogeneous, forest-dominated landscapes. Preserving or increasing the area of forests and other non-arable habitats is needed to safeguard a diversity of resources for hoverflies, and associated ecosystem services in farmland. Agricultural intensification has led to structurally simplified landscapes with reduced and fragmented resources for farmland insects. However, studies on the effects of landscape composition on farmland insects have mainly been performed in areas dominated by open arable land and semi-natural grasslands, while studies from forest-dominated landscapes are scarce. This research examined the effects of landscape composition on hoverfly species richness and abundance in arable land in boreal forest-dominated landscapes. Hoverflies were sampled in 22 mass-flowering caraway (Carum carvi) fields in Central Finland using pan traps. The effects of landscape composition on species richness and abundance were examined for all hoverflies, and for species groups with different adult habitat preferences. Landscape composition was measured as proportions of land cover classes within two different radii. Species richness and abundances of all hoverflies, forest species and open-habitat species increased with decreasing arable land cover and/or increasing forest cover within a 500 m radius (the two land cover classes strongly negatively correlated). Wetland species were most abundant in landscapes with an intermediate cover of arable land and forest, and most species-rich in landscapes with intermediate (10%) water cover. The species richness and abundance of mixed-habitat species increased with increasing cover of transitional woodland. Implications for insect conservation Our results show that most hoverfies in arable land benefit from increasing surrounding forest cover even in relatively heterogeneous, forest-dominated landscapes. Preserving or increasing the area of forests and other non-arable habitats is needed to safeguard a diversity of resources for hoverflies, and associated ecosystem services in farmland.

The skin has several functions, one of the most important of which is to protect the internal organs from external damage and the entry of germs. Since skin and wound healing is one of the mostly concerned issues worldwide, the development of wound healing remedies is one of the main fields in modern medical research.To evaluate the effect of the hydroalcoholic extract of Cumin carvi L. seed as one of the traditional medicinal plants used for wound healing through an in vivo model.Wide circular skin wounds (2 × 2 cm) were created on the dorsal area of 50 Sprague-Dawley male rats ​​following ethical principles. The animals were divided into five groups including no treatment, base gel, tetracycline treatment, 10% v/v hydroalcoholic extract of Cumin carvi L. seed treatment and 20% v/v hydroalcoholic extract of Cumin carvi L. seed treatment group. Treatment was performed within 20 days. On days 1, 3, 5, 7 and 10, photographs were taken, and the percentage of wound healing was calculated. Also, on the 10th day, the skin area was sampled for histopathology and on the 20The results of wound healing percentage showed that from day 3 onwards, there was a significant improvement between the group treated with 20% v/v hydroalcoholic extract of Cumin carvi L. and the negative control and basal gel groups (p0.05). According to histopathological and total protein content evaluations, the amount of collagen production and inflammation score in the Cumin carvi-treated groups confirmed the healing process compared to other groups.According to the results of this project, 20% v/v ethanolic extract of Cumin carvi L. has potential therapeutic effects in the treatment of skin wounds. Wounds are one of the health concerns, and the economic burden of wound care and healing has continued to increase over the past years. The healing effects of C. carvi. ethanolic extract on the wound were investigated. The histopathological and macroscopical evaluations, as well as total protein content, were measured to investigate its wound healing properties.

Using molecular data (nrDNA ITS, cpDNA psbA-trnH), the systematic position of the genus Palimbia in theUmbelliferae was studied. It was shown that Palimbia is a monophyletic taxon and belongs to the clade Pyramidoptereae.Taxa closely related to Palimbia, such as Carum buriaticum and Schulzia, are very different carpologically, but they arecharacterized by finely dissected leaves, which is a very rare trait for the Siberian Umbelliferae.

This report summarizes the highlights of a lively discussion between leaders in the cochlear implant (CI) field who also bring significant leadership experience at the practice and health system levels, as well as policy and research perspectives. The discussion revealed several areas in which established patterns of practice should be reconsidered to facilitate wider acceptance of the CI as part of an integrated continuum of hearing healthcare. The importance of continued innovation to advance outcomes, lower cost, and increase access was emphasized. Trends in healthcare funding, which increasingly reward quality at lower cost, will also challenge longstanding assumptions that have influenced program design. Proactive efforts that pursue consistent value in the episode of surgical care while establishing innovative delivery models for audiological and rehabilitation services are the best hope for a future of equitable access and expanding impact.

This study aimed to investigate the fungal species isolation and confirmation by the Multiplex PCR method in aquatic fish. Evaluation of the inhibitory effect of nano-essential oils of Carum copticum on isolated fungal species was also conducted in this study. The PCR results showed that 3 out of 5 samples were diagnosed with Fusarium solani, and two of them were positive for Saprolegnia. Moreover, in 0.1% of the femalesamp;#39; nanoparticles, one peak appeared that showed a particle with an average diameter of 360 nm, and two nanoparticles showed a peak with a mean diameter of 242 nm. The results of minimum inhibitory concentrations (MIC) and minimum fungicidal concentrations (MFC) showed that 0.01% nano essential oil had 0.08 and 0.07 mg/ml MIC values against Fusarium solani and Saprolegnia, respectively. Gram/ml was on the growth of Fusarium solani species. The essential oils of female plants had an MIC of 0.07 in 0.1% essential oil and 0.03 mg/ml in 0.01% essential oil in Saprolegnia. Furthermore, in the case of 0.1% nano essential oil, the results showed the MIC values of 0.04 and 0.03 mg/ml against Fusarium solani and Saprolegnia, respectively. The MFC values of 0.1% nano essential oil were 0.1 and 0.07 mg/ml against Fusarium solani and Saprolegnia,respectively. It was not found on Fusarium and Saprolegnia. Overall, the results of this study using PCR for direct detection showed that 70% and 50% of the samples were Fusarium solani and Saprolegnia positive, respectively; therefore, the PCR was an efficient method for the detection of fungi. According to the results of nano-essential oil (0.1%) of females, this nano-essence had a strong inhibitory effect on Fusarium solani and Saprolegnia.

Despite studies on the effects of medicinal plants on reproductive performance, the effect of extracts broccoli and caraway on serum and testicular oxidative biomarkers, testicular structure and function and sperm quality before and after cryopreservation has not been studied. Sixty-three male mice were divided into nine controlled and treated groups as follow: control, broccoli (200 mg/kg), broccoli (300 mg/kg), caraway (200 mg/kg), caraway (300 mg/kg), broccoli -caraway (200 mg/kg), broccoli (300 mg/kg)-caraway (200 mg/kg), broccoli (200 mg/kg)-caraway (300 mg/kg), broccoli-caraway (300 mg/kg). After 42 days of treatment, the animals were sacrificed and blood sample and testicular tissue were collected for biochemical and histological measurements. Sperm quality was also measured before and after cryopreservation. The results showed that the diameter and number of spermatogonium, primary spermatocytes, spermatids and sperm count were significantly increased by broccoli (300 mg/kg), while level of them were significantly decreased by caraway (300 mg/kg) compared to other groups (p 0.01). Sperm viability and motility after thawing significantly improved by broccoli (300 mg/kg) compared to control. Testosterone levels significantly increased by broccoli (300 mg/kg) compared to control and caraway (300 mg/kg). The serum and testicular SOD and CAT activity significantly increased by broccoli (300 mg/kg) compared to other groups (p 0.05). MDA and DNA fragmentation levels significantly increased by caraway (200 and 300 mg/kg) compared to others (p 0.01). It can be concluded that broccoli extract in a dose-dependent manner than caraway extract could improve serum and testes oxidative biomarkers, testicular structure and function, and sperm quality before and after cryopreservation.

To explore a novel kind of green composite material having excellent antibacterial, antifungal ability and specific-targeting capability for pharmaceutical uses, a novel kind of bio-composite was prepared using sodium purified clay as carrier of Caraway essential oil (CEO). Gas chromatography-mass spectroscopy (GC–MS) analyses of CEO reveals that Carvone (68.30%) and Limonene (22.54%) are the two major components with a minimum inhibitory concentration (MIC) value equal to 125 mg/mL against Staphylococcus (S) aureus bacteria and Candida albicans fungi. Clay from Zaghouan was purified and characterized by X-ray Photoelectron Spectroscopy (XPS), X-ray diffraction (XRD), Fourier transformed infrared spectroscopy (FT-IR) and N2 adsorption–desorption (BET method). Results obtained by chromatograph equipped with a flame ionization detector (GC-FID) show that the concentration of 130 mg/mL of essential oil and 5 h of contact with the purified clay are the optimal conditions for the bio-hybrid formation. The pseudo-second-order model can describe the kinetic study of the adsorption of Carvone and Limonene on sodium montmorillonite, and the adsorption isotherms have been established to the Langmuir type. Limonene registers a maximum adsorption value equal to 3.05 mg/g of clay however Carvone register the higher amount of adsorption (19.98 mg/g) according to its polarity and the abundance of this compound in the crude CEO. X-ray diffraction, Fourier transformed infrared spectroscopy, elemental analyses (CHN) and X-ray fluorescence characterization valid the success adsorption of CEO in sodium montmorillonite surface. The purified clay/CEO hybrid (purified clay/CEO) combined the advantages of both the clay and the essential oil used in exerting the antibacterial and antifungal activity, and thus, the composite has a double antibacterial and antifungal activity compared to the separately uses of inactive clay and CEO, suggesting the great potential application in pharmaceutical treatments.

In previous work, we tested the immunomodulatory effect of Nigella sativa (NS) fatty oil. Our results demonstrated that unrefined, obtained by cold pressing black cumin seed oil inhibited lymphocytes' proliferation and induced their apoptosis in a dose-dependent manner. In this study, we examined the immunomodulatory properties of essential oil (EO) obtained from the NS seeds by hydrodistillation and its two main constituents: thymoquinone (TQ) and p-cymene. We analyzed the proliferation, activation phenotype, and apoptosis rates of human T lymphocytes stimulated with an immobilized monoclonal anti-CD3 antibody in the presence of serial ethanol dilutions of tested oil or serial distilled water dilutions of tested compounds with flow cytometry. Our results showed that NSEO significantly inhibited the proliferation of CD4

Although there were a number of studies on the section Oceanica of the genus Protoperidinium, most of the published figures did not well revealed the clear features of the anterior intercalary plates. In this paper, Protoperidinium carum was re-described in details of cell morphology, plate patterns and thecal ornamentation, especially the second anterior intercalary plate (2a) is wide pentagonal instead of hexagonal type as in the previous descriptions. This species was illustrated with line drawing, light and scanning electron microscope photographs. P. carum was newly recorded in Southeast Asia and Vietnamese waters.

In this study, Pectin/Nanoclay (montmorillonite)/Carum copticum Essential oils/β-Carotene (Pec/Clay/CCE/βC) composite film was prepared. The effect of β-Carotene (βC) and Carum copticum Essential oils (CCE) concentration on the antioxidant activity and color/mechanical properties of Pec/Clay/CCE/βC film was studied. The morphology and antibacterial activity of film were studied. The films containing maximum essential oil and β-carotene showed the best antibacterial activity, antioxidant activity, flexibility and firmness. So the Pec/Clay/CCE0.5%/BC0.03% film as the optimum film was used for packaging of local butter. Oxidative stability, microbial count, and color properties (L*, a* and b*) of butter packaged with active film (Pec/Clay/CCE/βC) were investigated. Results showed that Pec/Clay/CCE/βC film was effective against Bacillus cereus (B. cereus) more than Escherichia coli (E. coli). According to the results active packaged butter had the highest oxidative stability, lowest microbial load, and the least color change during storage. In the packaging process, Pec/Clay/CCE/βC film color was changed from orange to light yellow and this color change was used as a smart color indicator to detect the oxidation of butter and expiration time of butter.

Background and objective The use of aromatic and herbal plants as a feed additive became a new trend in feeding dairy cows to enhance animal productivity. This study was conducted to evaluate the effect of adding some herbal and aromatic plants (Melissa, Fennel and Caraway) at 0.7% of total DM of rations. Materials and methods Three herbal plants were evaluated in this study (melissa, fennel and caraway) by using thirteen Holstein Friesian cows. Cows were in 3rd and 5th lactation seasons were used as one experimental group by swing over design in lactation experiment (control then T1 then T2 then T3 then control). Nutrients digestibility, milk production, milk composition and blood constituents were determined. Results Data indicated that nutrients digestibility and nutritive value were improved with herbal plants addition, especially with caraway treatment which recorded significantly (p>0.05) the highest values. In the same trend, Actual milk yield, 4% FCM and fat content were significantly (p>0.05) increased when cows fed rations supplemented with fennel and caraway. The addition of melissa decreased the concentration of Total Saturated Fatty Acids (TSFA) in the milk. Normal ranges for blood parameters with no negative impact on animal health were observed with experimental rations. Conclusion It could be concluded that caraway addition at 0.7% of the total dry matter of dairy rations, has a great potential to improve animal productivity and enhance the quality of milk fatty acids profile.

Essential oils are widely used in the food and cosmetics industry as natural flavoring and fragrance substances. For this reason, a thorough quality control applying selected analytical methods is required. Oxidation along with hydroperoxide formation is an important drawback during production and storage of essential oils. Hydroperoxides constitute the main products formed upon photo-oxidation of essential oils. Due to hydroperoxide instability, gas chromatography (GC) and high-performance liquid chromatography (HPLC) analyses are required. According to the European Pharmacopoeia, titration is the official method for oxidation assessment. However, this analysis is time-consuming, and large sample quantities are required. Here, we present a simple and accurate spectrophotometric method for the detection of peroxide trace amounts in essential oils and terpenes. The principle is based on the formation of Wurster's red, which is enforced by the peroxide-driven oxidation of

Sumac, cumin, and caraway are the most common spices used in the Middle Eastern cuisine, which are also known as herbal medicine. Thus, the present study was conducted to provide comprehensive information and analysis on the oil extracted from spices. The oils of caraway, cumin, and three different varieties of sumac seeds were extracted using hexane, and oil content, fatty acid composition, physicochemical properties, oxidative stability, antioxidant properties, and sterol compositions of oils extracted from spices were analyzed. The oil content ranged from 12 to 16% among different samples. Results obtained regarding the assessment of fatty acids composition showed oleic acid as predominant fatty acid present in different varieties of sumac, while linoleic acid was the dominant fatty acid of cumin and caraway. The α-tocopherol content of spices was equal to 392.06, 103.36 and 89.70 mg kg−1 for oils extracted from different varieties of sumac, caraway, and cumin, respectively. The sumac samples had high γ-tocopherol content (344.27–45.63 mg kg−1) and indicated unique oxidative stability for at least 50 h with no significant differences between the samples (P

This research with a factorial arrangement was undertaken to investigate physiological responses of ajowan plants to foliar treatment of salicylic acid (1 mM) and nano-Fe2O3 (3 mM) under various salinity levels (0, 4, 8, 12 dS m-1 NaCl, respectively). Rising salinity enhanced sodium and endogenous SA contents, soluble sugars, protein, glycine betaine, proline, antioxidant enzymes activities, ROS generation, and lipid peroxidation, while reduced potassium and iron contents, membrane stability index, leaf water content, leaf pigments, root and shoot biomasses, and seed yield. Application of particularly SA and SA+nano-Fe2O3 alleviated salt toxicity via enhancing K+ uptake, K+/Na+ ratio, Fe content, endogenous level of SA, the activities of antioxidant enzymes (superoxide dismutase, catalase, peroxidase, and polyphenol oxidase), and most of the osmolytes. These changes were resulted in improving membrane stability index, leaf water content, leaf pigments, root and shoot growth, and finally seed yield of plants under moderate and severe salinities. Therefore, these treatments can additively enhance salt tolerance and physiological performance of ajowan through increasing antioxidant capacity, osmolytes, and photosynthetic pigments. Graphical Abstract .

Abused refrigerated temperatures are described as unacceptable deviations from the optimal temperature, occurring frequently during transportation of food products. Escherichia coli O157:H7 is a serious contaminant of meats and meat products due to its ability to grow at abused temperatures (> 10 °C). The aim of this study was to evaluate the antibacterial activity of Carum copticum essential oil for the control of Escherichia coli O157:H7 using laboratory media and minced beef at severe abused refrigerated temperature (15 °C). A comparative quantitative reverse transcription real-time PCR was used to assess effects of temperature and Carum copticum essential oil at sub-minimum inhibitory concentrations on bacterial growth and Shiga-toxin gene (stx1A and stx2A) expression. Results indicated that Carum copticum essential oil inhibited growth of E. coli O157:H7 in tryptone soy broth (TSB) media at all sub-MIC values until Hour 48. However, bacterial population increased progressively until Hour 72 at essential oil concentration of 0.75% (ml g−1) and reached 8.6 log CFU g−1 in minced beef. The essential oil at concentration of 0.005% (ml g−1) increased stx gene expression at all times, but increased stx gene expression (0.015%) at Hour 24 in TSB media. The expression rate of stx1A in minced beef decreased progressively (10.39 and 7.67 folds for 0.5 and 0.75%, respectively) and expression of stx2A was variable in minced beef during storage. In conclusion, results from this study have shown that effects of Carum copticum essential oil on growth and virulence gene expression are not necessarily correlated and temperature, essential oil concentration, investigated gene type, and bacterial growth environment (in vivo or in vitro) are effective as well.

The aim of this study was to evaluate the analgesic and anti-inflammatory effects of the hydroalcoholic extracts of Malva sylvestris flowers or Carum carvi and Medicago sativa seeds, alone and in combination, which have been used in traditional Iranian medicine.Male Wistar rats were divided into 6 treatment groups: distilled water, sodium salicylate (SS), M. sylvestris extract (600 mg/kg), C. carvi extract (600 mg/kg), M. sativa extract (300 mg/kg) and combined extract (including 300 mg/kg M. sylvestris and C. carvi extracts, and 150 mg/kg M. sativa extract). The formalin pain model was used to evaluate the antinociceptive effects of the treatments. For anti-inflammatory effect, acute (one hour after injection) and chronic (during a week after injection) paw inflammation was measured after subcutaneous injection of 2.5% formalin in the hindpaw. Finally, tissue samples from all groups were prepared for histopathological studies.The combined extract significantly inhibited the nociception in the acute phase of the formalin test (P 0.001). In the chronic phase, all the extracts and SS had significant analgesic effect (P 0.001). Analgesic activity of the combined extract was significantly stronger than SS (P 0.01). In the acute inflammation model, M. sylvestris, C. carvi and the combined drug had significant inhibitory effects against paw edema (P 0.05). All extracts, individually and in combination, significantly alleviated chronic paw inflammation (P 0.01). The combined extract had much more anti-inflammatory activity than SS (P 0.05). Histopathological results indicated improvement and reduction of inflammatory factors in the treatment groups.M. sylvestris, C. carvi and M. sativa have analgesic and anti-inflammatory properties. Potentially, each of these extracts or a mixture of them might be a valuable alternative drug to control pain and inflammation.

The aim of this study was to evaluate the addition of caraway (1%) in fast-growing and slow-growing broiler chickens' diet and its effect on performance parameters, blood biochemical profile, and relative organ sizes and ileum morphology in slow-growing broilers. Two separated experiments were performed. On the first day of age, the broilers were divided into two equal groups (Control and Caraway) with six replicates per treatment in both experiments. Experiment I: The total of 276 male fast-growing Ross 308 broiler chickens were used. The trial lasted from the first day to 35th day of chickens' age. Experiment II: The total of 216 male slow-growing (Hubbard JA 57) broilers were used. The trial lasted from the first to 50th day of chickens' age. Mean liveweight, weight gain, feed conversion ratio, blood biochemical parameters and relative organ sizes were not significantly different in these trials. The group of slow-growing broilers supplemented with 1% of caraway in the diet showed longer villi and deeper crypt in the ileum after 50 days of life. Based on our results, it can be stated that the proportion of 1% caraway in fast-growing and slow-growing broiler chickens' diet did not influence performance parameters, blood biochemical profile and relative organ sizes. In case of the experiment with the slow-growing broilers supplemented with caraway, a significant difference in the height of the villi and the depth of the crypts was found. Caraway can be included in the broiler chickens' diets without negative effects, but further study of the effect on the intestinal morphology is necessary. info:eu-repo/semantics/openAccess

Breast cancer is the most commonly diagnosed invasive non-skin malignancy in women worldwide, and it is the leading cause of cancer-related deaths in them.Results showed that higher concentrations (50 μg/mL) ofThere was decreased cell proliferation and cell viability when

Biotechnology and nanotechnology are important tools for understanding biochemical pathways. They can be used efficiently for stimulating and increasing the production of secondary metabolites in medicinal plants. The present study aimed to identify the γ-terpinene synthase gene (CcTPS2) as an effective contributor to the biosynthetic pathway of monoterpenes. The effects of silver nanoparticles (AgNPs; 50 and 100 mg l

This study aimed to investigate the efficiency of chemically characterised

Due to the increasing rate of invasive fungal infections and emerging antifungal resistance, development of novel antifungal drugs has been an urgent necessity. Antifungal peptides (AFPs) have recently attracted attention due to their unique ability to evade drug-resistant fungal pathogens. In this study, a novel AFP, Cc-AFP1, with a molecular weight of ~3.759 kDa, was isolated from Carum carvi L., purified by ammonium sulfate precipitation and reversed-phase HPLC and finally identified by sequence analysis using Edman degradation. Peptide sequence analysis revealed a fragment of 36 amino acid residues as RVCFRPVAPYLGVGVSGAVRDQIGVKLGSVYKGPRG for Cc-AFP1 with a net charge of +5 and a hydrophobicity ratio of 38%. The antifungal activity of Cc-AFP1 was confirmed against Aspergillus species with MIC values in the range of 8–16 µg/ml. Cc-AFP1 had less than 5% hemolytic activity at 8–16 µg/ml on human red blood cells with no obvious cytotoxicity against the HEK293 cell line. Stability analysis showed that the activity of Cc-AFP1 was maintained at different temperatures (20°C to 80°C) and pH (8 to 10). The results of a propidium iodide uptake and transmission electron microscopy showed that the antifungal activity of Cc-AFP1 could be attributed to alteration in the fungal cell membrane permeability. Taken together, these results indicate that Cc-AFP1 may be an attractive molecule to develop as a novel antifungal agent combating fungal infections cause by Aspergillus species.

To date, only a handful of pesticides have been authorized by the European Council for the protection of stored grains. Resistance issues and ecotoxicity concerns necessitate the development of ecofriendly tools in that direction. In this review, we refer to the recent findings on plant extracts and pure plant-derived substances with promising biological activity and the potential to be used as biopesticides for stored products. The main aim of biopesticides is to be effective against target pests, without harming humans and the environment. Many plant species, among those reported herein, are part of the human diet, and are thus not harmful to humans. Edible plant extracts produced with inorganic solvents represent safe candidates for use as repellants, fumigants or contact pesticides. Cinnamon, rosemary, parsley, garlic, oregano and basil are found in products destined for human consumption but also display significant biological activities. Interestingly, cinnamon is one of the most widely tested botanical matrixes, exhibiting the best lethal effects on almost all insect and mite taxa reported herein (Acaroidea, Coleoptera and Lepidoptera), followed by basil and garlic. Prunus persica,Azadirachta indica A. Juss and Carum sp. seem to be very promising too as miticides and/or insecticides, with A. indica already being represented commercially by a plant-derived acaricidal formulation.

The current investigation assessed the effect of pectin (PE) biodegradable nanocomposite coating containing curcumin nanoparticles (CNP) and ajowan (Carum copticum) essential oil nanoemulsion (ANE) combined with low-dose gamma irradiation on microbial, physiochemical, and sensorial qualities of lamb loins during refrigeration conditions. Active coating combined with gamma irradiation reduced the count number of mesophilic and psychrotrophic bacteria, lactic acid bacteria, Enterobacteriaceae; and minimized lipid and protein oxidation changes, total volatile basic nitrogen content, met-myoglobin formation, and color deterioration in the loin samples. The increased shelf-life of lamb loins up to 25 days compared with 5 days assigned for the control group can be associated with the application of ionizing radiation and edible PE coating containing CNP and ANE, which might be due to the synergistic or additive effects of treatments. Overall, as an effective preservation technique, a combination of PE + CNP + ANE and irradiation can be recommended for prolonging the shelf-life of lamb loins during refrigerated storage.

Digas colic drops (DCD-684) is a polyherbal formulation containing decoctions of five medicinal plants namely Carum carvi L., Foeniculum vulgare Mill, Mentha arvensis L., Mentha piperita L. and Zingiber officinale Roscoe. These plants have been extensively used in traditional medicine for the treatment of various gastrointestinal diseases including abdominal colic. This study was conducted to determine the spasmolytic effect of DCD-684 (100% v/v) and its individual plant components on isolated rabbit jejunum (in vitro) and their possible mechanism of action. The effects were evaluated on spontaneous and pre-contracted tissues using KCl (80mM) and other contractile agonists including acetylcholine (0.3µM), carbamylcholine (0.3µM), serotonin (10 µM) and histamine (100µM) in the presence and absence of DCD-684. The various concentrations of DCD-684 (0.1-3% v/v) demonstrated spasmolytic effects on both spontaneous (IC50=0.75%) and KCl-induced contractions (IC

We describe the production of doubled haploids through anther culture in caraway. Induction conditions for the cultivation of donor plants, anther collection, composition of culture media, and physical induction conditions for embryogenesis have been described. As a result, responsive lines with numerous haploid embryo production were obtained, which after colchicine treatment became fertile. From a practical point of view, two doubled haploid populations are tested under field conditions.

A novel nepovirus was identified and characterised from caraway, and tentatively named caraway yellows virus (CawYV). Tubular structures with isomeric virus particles typical for nepoviruses were observed in infected tissues by electron microscopy. The whole genome of CawYV was identified by high throughput sequencing (HTS). It consists of two segments with 8026 nt for RNA1 and 6405 nt for RNA2, excluding the poly(A) tails. CawYV-RNA1 shared closest nt identity to peach rosette mosaic virus (PRMV) with 63%, while RNA2 shared 41.5% with blueberry latent spherical virus (BLSV). The amino acid sequences of the CawYV protease-polymerase (Pro-Pol) and capsid protein (CP) regions share the highest identities with those of the subgroup C nepoviruses. The Pro-Pol region shared highest aa identity with PRMV (80.1%), while the CP region shared 39.6% to soybean latent spherical virus. Phylogenetic analysis of the CawYV-Pro-Pol and -CP aa sequences provided additional evidence of their association with nepoviruses subgroup C. Based on particle morphology, genomic organization and phylogenetic analyses, we propose CawYV as a novel species within the genus Nepovirus subgroup C. Electronic supplementary material The online version of this article (10.1186/s12985-019-1181-1) contains supplementary material, which is available to authorized users.

Objectives Microbial biofilms has attracted interest in the recent years because they has become the most important cause of nosocomial infections. This study was aimed to examine the antibacterial activities of Carum copticum extracts on the development of microbial biofilms and planktonic form of six pathogenic bacteria. Methods Antimicrobial activity of the crude extracts against the planktonic form of six pathogenic bacteria: Bacillus cereus, Staphylococcus aureus, Pseudomonas aeruginosa, Escherichia coli, Acinetobacter baumannii and Klebsiella pneumonia was evaluated by using the disc diffusion method. Minimal Inhibitory Concentration (MIC) and Minimal Bactericidal Concentration (MBC) values was determined by macro-broth dilution technique. Anti-biofilm effects were assessed by microtiter plate method. The chemical composition of the herbal extract was identified by GC-MS. Results According to disc diffusion test (MIC and MBC) the ability of C. copticum extracts for inhibition of bacteria in planktonic form was confirmed. The best inhibitory effect of this plant on S. aureus and low inhibitory effect on A. baumannii in planktonic forms were observed. These extracts were efficient to inhibit biofilm structures and concentration of each extract has direct relation with inhibitory effect. The maximum and minimum inhibitory effects of C. copticum methanolic extract on biofilm formation were observed on A. baumannii (98%) and K. pneumoniae (19%) respectively. Conclusion The GC-MS analysis revealed that five active compounds were present in the extract of this plant. Data obtained, suggested that the C. copticum extracts applied as antimicrobial agents against these pathogens particularly in biofilm making.

Caraway contains terpenes such as carvone, limonene and carveol, that have antibacterial and antifungal properties. Subcritical-water extraction (SWE) can be used to extract terpenes by changing temperature under high pressure. This study evaluated the SWE of terpenes from caraway when varying the extraction conditions of temperature (110 °C-190 °C), time (5-15 min), and particle size (1000, 850-1000, 425-850, and 425 μm). The optimal conditions for the extraction of carvone, which determines the quality of caraway, were found to be 170 °C, 15 min, and a particle size of 425 μm. Also, the carvone yield was much higher when using SWE (28.5 mg/g caraway) than for solvent extraction (20.2 mg/g caraway) and hydrodistillation (19.8 mg/g caraway). The overall results showed that oxygenated terpene like carvone has a high solubility in subcritical water, and nonoxygenated terpene like limonene can partially be converted to carvone via a process of SWE.

Caraway (Carum carvi L.) essential oil is a candidate for botanical herbicides. A hypothesis was formulated that the sand-applied maltodextrin-coated caraway oil (MCEO) does not affect the growth of maize (Zea mays L.). In the pot experiment, pre-emergence application of five doses of MCEO was tested on four maize cultivars up to the three-leaf growth stage. The morphological analyses were supported by the measurements of relative chlorophyll content (SPAD), two parameters of chlorophyll a fluorescence, e.g., Fv/Fm and Fv/F0, and fluorescence emission spectra. The analyzed MCEO contained 6.5% caraway EO with carvone and limonene as the main compounds, constituting 95% of the oil. The MCEO caused 7-day delays in maize emergence from the dose of 0.9 g per pot (equal to 96 g m−2). Maize development at the three-leaf growth stage, i.e., length of roots, length of leaves, and biomass of shoots and leaves, was significantly impaired already at the lowest dose of MCEO: 0.4 g per pot, equal to 44 g m−2. A significant drop of both chlorophyll a fluorescence parameters was noted, on average, from the dose of 0.7 g per pot, equal to 69 g m−2. Among the tested cultivars, cv. Rywal and Pomerania were less susceptible to the MCEO compared to the cv. Kurant and Podole. In summary, maize is susceptible to the pre-emergence, sand-applied MCEO from the dose of 44 g m−2.

Herbs and spices have been used since antiquity for their nutritional and health properties, as well as in traditional remedies for the prevention and treatment of many diseases. Therefore, this study aims to perform a chemical analysis of both essential oils (EOs) from the seeds of Carum carvi (C. carvi) and Coriandrum sativum (C. sativum) and evaluate their antioxidant, antimicrobial, anti-acetylcholinesterase, and antidiabetic activities alone and in combination. Results showed that the EOs mainly constitute monoterpenes with γ-terpinene (31.03%), β-pinene (18.77%), p-cymene (17.16%), and carvone (12.20%) being the major components present in C. carvi EO and linalool (76.41%), γ-terpinene (5.35%), and α-pinene (4.44%) in C. sativum EO. In comparison to standards, statistical analysis revealed that C. carvi EO showed high and significantly different (p &lt, 0.05) antioxidant activity than C. sativum EO, but lower than the mixture. Moreover, the mixture exhibited two-times greater ferric ion reducing antioxidant power (FRAP) (IC50 = 11.33 ± 1.53 mg/mL) and equipotent chelating power (IC50 = 31.33 ± 0.47 mg/mL) than the corresponding references, and also potent activity against 2,2-diphenyl-1-picrylhydrazyl (DPPH) (IC50 = 19.00 ± 1.00 mg/mL), β-carotene (IC50 = 11.16 ± 0.84 mg/mL), and superoxide anion (IC50 = 10.33 ± 0.58 mg/mL) assays. Antimicrobial data revealed that single and mixture EOs were active against a panel of pathogenic microorganisms, and the mixture had the ability to kill more bacterial strains than each EO alone. Additionally, the anti-acetylcholinesterase and α-glucosidase inhibitory effect have been studied for the first time, highlighting the high inhibition effect of AChE by C. carvi (IC50 = 0.82 ± 0.05 mg/mL), and especially by C. sativum (IC50 = 0.68 ± 0.03 mg/mL), as well as the mixture (IC50 = 0.63 ± 0.02 mg/mL) compared to the reference drug, which are insignificantly different (p &gt, 0.05). A high and equipotent antidiabetic activity was observed for the mixture (IC50 = 0.75 ± 0.15 mg/mL) when compared to the standard drug, acarbose, which is about nine times higher than each EO alone. Furthermore, pharmacokinetic analysis provides some useful insights into designing new drugs with favorable drug likeness and safety profiles based on a C. carvi and C. sativum EO mixture. In summary, the results of this study revealed that the combination of these EOs may be recommended for further food, therapeutic, and pharmaceutical applications, and can be utilized as medicine to inhibit several diseases.

To fight the rising resistance of microorganisms to antibiotics, a strategy followed by several researchers is to focus on natural compounds, such as essential oils, as a source of potent antibacterial compounds. These last decades, hundreds of original papers have been written about microbiological assays that prove the antibacterial activity of essential oils and their use in the medical field. But can we really compare all the data available in the literature when the raw material, the microbiological assays, and/or the strains are different from one article to another? This review will point out the differences and the inadequate practices found in published articles that tested 2 lesser-studied essential oils–Spanish lavender and the ajowan–by the broth dilution method against Staphylococcus aureus, a human pathogenic bacterium. Many pitfalls were found in the literature, for example, a variable chemical composition rarely underlined by the authors, unidentified strains or clinical strains used without a related antibiogram, a lack of quality controls, and the assertion of questionable positive results. At last, some general guidelines that should be followed by every scientific researcher will be discussed.

Aim. One of the main problems in dentistry is the injury caused by the long-term application of an ill-fitting denture. The existence of multiple microorganisms along with the susceptibility of the tissue conditioners to colonize them can lead to denture stomatitis. This study is aimed at developing a tissue conditioner incorporated with Carum copticum L. (C. copticum L.) for the effective treatment of these injuries. Materials and Methods. The Carum copticum L. essential oil composition was determined by gas chromatography-mass (GC-mass) spectrometry. The antimicrobial activity of the essential oil against the standard strains of bacterial and fungal species was determined by broth microdilution methods as suggested by the Clinical and Laboratory Standards Institute (CLSI). The physical and chemical properties of the prepared tissue conditioner were investigated by viscoelasticity, FTIR assays, and the release study performed. Furthermore, the antibiofilm activity of the Carum copticum L. essential oil-loaded tissue conditioner was evaluated by using the XTT reduction assay and scanning electron microscopy (SEM). Results. The main component of the essential oil is thymol, which possesses high antimicrobial activity. The broth microdilution assay showed that the essential oil has broad activity as the minimum inhibitory concentration was in the range of 32-128 μg mL-1. The viscoelasticity test showed that the essential oil significantly diminished the viscoelastic modulus on the first day. The FTIR test showed that Carum copticum L. essential oil was preserved as an independent component in the tissue conditioner. The release study showed that the essential oil was released in 3 days following a sustained release and with an ultimate cumulative release of 81%. Finally, the Carum copticum L. essential oil exhibited significant activity in the inhibition of microbial biofilm formation in a dose-dependent manner. Indeed, the lowest and highest amounts of biofilm formation on the tissue conditioner disks are exhibited in the Streptococcus salivarius and Candida albicans by up to 22.4% and 71.4% at the 64 μg mL-1 concentration of C. copticum L. with a statistically significant difference ( P < 0.05 ). Conclusion. The obtained results showed that the Carum copticum L. essential oil-loaded tissue conditioner possessed suitable physical, biological, and release properties for use as a novel treatment for denture stomatitis.

The effects of Ajwain essential oil and its major constituents were investigated against newly fourth instar larvae of Tuta absoluta, a major pest of tomato cropping in Iran and other parts of the world. The study included individual efficacy of each compound and determination of their synergistic or antagonistic efficacy. We also determined the activities of detoxifying enzymes in treated insects. According to the results, the Ajwain essential oil and thymol showed the highest toxicity against T. absoluta larvae (LC50 = 6.14 and 7.72 μL/mL, respectively, and LC30 = 3.05 and 3.57 μL/mL, respectively). The ɤ-terpinene and p-cymene had lesser toxicity compared to other compounds. The larvicidal potency increased by binary mixtures of active constituents, such as thymol + p-cymene and thymol + ɤ-terpinene. On the other hand, ɤ-terpinene + p-cymene mixture demonstrated antagonistic effect on the larvae. The esterases and glutathione S-transferases were significantly increased in all treatments. Finally, our results revealed a significant inhibition of AChE activity in the treated larvae by all treatments except for ɤ-terpinene + p-cymene. In vitro experiments representing AChE inhibition with IC50 values were recorded 0.370, 0.457, 0.528, 1.094 and 1.323 μL/mL for thymol + p-cymene, thymol + ɤ-terpinene, thymol, ɤ-terpinene and p-cymene, respectively. Thymol demonstrated significant potential as a controlling agent of T. absoluta larvae, both larvicidal, compatible with other compounds with strong AChE inhibition properties. These finding could pave the way for development of new botanicals based on EO constituents which should be completed with preparation of an efficient formulation and field trials.

Caraway (Carum carvi) is a widespread and frequently used spice and medicinal plant with a long history of cultivation. However, due to ongoing climatic changes, the cultivation is becoming increasingly risky. To secure caraway cultivation in future, timely breeding efforts to develop adapted material are necessary. Analysis of genetic diversity can accompany this process, for instance, by revealing untapped gene pools. Here, we analyzed 137 accessions using genotyping by sequencing (GBS). Hence, we can report a broad overview of population structure and genetic diversity of caraway. Population structure was determined using a principal coordinate analysis, a Bayesian clustering analysis, phylogenetic trees and a neighbor network based on 13,155 SNPs. Genotypic data indicate a clear separation of accessions into two subpopulations, which correlates with the flowering type (annualvs. biennial). Four winter-annual accessions were closer related to biennial accessions. In an analysis of molecular variance, genetic variation between the two subpopulations was 7.84%. In addition, we estimated the genome size for 35 accessions by flow cytometry. An average genome size of 4.282 pg/2C (± 0.0096 S.E.) was estimated. Therefore, we suggest a significantly smaller genome size than stated in literature.

This research is carried out in order to characterize the actual contamination by two ubiquitous environmental pollutants, plasticizers and Bisphenol A, in spices (black pepper, caraway and coriander) and aromatic herbs (fennel, laurel, mint, oregano, rosemary, thyme and verbena) from Algeria (n = 26), Tunisia (n = 65) and Italy (n = 53). Algerian samples seem to contain fewer residues than Italian and Tunisian samples. Among the Italian samples, only aromatic herbs, precisely mint, oregano, and laurel, were contaminated. In general, all Tunisian samples showed five plasticizers residues: the caraway, among the spices, and the rosemary, among the aromatic herbs, are found to contain more residues. Also, dietary intake of these contaminants by spices and aromatic herbs under analysis seems not to constitute a risk to the consumers.

The methanolic extract (ME) of C. montanum obtained by a hydo-alcoholic maceration and its polyphenol content was evaluated by Folin-Ciocalteu method. This extract and C. montanum essential oil (EO)were screened for antimicrobial activity against 21 microbial strains by agar diffusion method. MICs of the EO were determined by the broth micro dilution method. The action mechanism of EO was determined on the susceptible strains by the time kill assay and the lysis experience. Antioxidant properties were studied by both free DPPH radical scavenging and reducing power techniques. The TPC in the ME showed a high level of 101.50 ± 5.33 mg GAE /mg. B. cereus was the most sensitive strain with MIC of 55.5 µg/ml , then K. pneumoniae (111 µg/ml). A remarkable decrease in a survival rate as well as in the absorbance at 260 nm were recorded, which suggest that the cytoplasm membrane is one of the targets of the EO. Antioxidant effects concentration were dependent and IC50 values were 1.09 ± 0.37 µg/ml for the EO and 65.04 ± 0.00 µg/ml for the ME by DPPH method and a reducing power dose-dependent. In conclusion, C. montanum extracts showed potent which could be exploited in the food industry for food preservation.

An experiment was conducted to evaluate the efficacy of nine botanical extracts on plant growth, yield and pest management in eggplant field. Aqueous extracts of dried leaves of Nicotiana tabacum, Aegle marmelos, Ficus hispida, Lawsonia inermis, Vitex negundo and seeds of Carum roxburghianum, Corchorus capsularis and Swietenia macrophylla and bulb of Allium sativum were prepared and sprayed in experimental eggplant field at University of Rajshahi during January 1, 2014 to May 5, 2014. Out of these nine botanicals, Nicotiana tabacum extract showed best performance against pest attack in eggplant field. The leaf extract of Ficus hispida also showed good efficacy in the protection of eggplant from pest attack. The highest plant length and fruit yield were recorded in the treatment of Nicotiana tabacum , whereas second and third highest productions were observed in Aegle marmelos and Ficus hispida treatments, respectively. Both Allium sativum and Carum roxburghianum extracts were found to show phyto-toxicity to eggplant and hampered the plant growth and yield. J. Environ. Sci. & Natural Resources, 10(1): 137-140 2017

Background: Transforming growth factor (TGF)-beta 2 signaling pathways and their receptors exert a pivotal role in behavior and fate of tumor cells. Therefore, these pathways are target of drug discovery researches. In this study, we evaluated the effects of the aqueous extract of Trachyspermum copticum (L.) link (carum) seeds on TGF-beta receptor 1 and 2 genes coding the heterodimer complex of receptor in MCF-7 cell line of human breast cancer. Methods: Non-cytotoxic concentrations of the extract determined by 3-(4,5-Dimethylthiazol-2-yl)-2,5-Diphenyltetrazolium bromide (MTT) test and cells treated with non-cytotoxic concentrations (5 and 40 µg/ml) of extract for 24 hours. Then, to evaluate the expression of TGF-beta receptors 1 and 2 genes at the level of transcription, real-time polymerase chain reaction (PCR) was performed (comparing the control group). Data were analyzed using REST® software and analysis of variance test. Level of significance was set at 0.05. Findings: Cells treated with concentration of 5 µg/ml of extract showed reduction in gene transcription levels to almost half (0.52) (P = 0.015); and in cells treated with concentration of 40 µg/ml of extract, gene transcription levels increased to 1.34 times (P = 0.066) comparing to control group. Treatment of cells with extract showed no meaningful changes in TGF-beta receptor 2 gene expression at the level of transcription (P = 0.148). Conclusion: Results suggest that treatment of MCF-7 cells with low concentration of aqueous extract of Trachyspermum copticum (L.) link seeds can affect the TGF-beta receptor 1 gene transcription, but not the TGF-beta receptor 2; and alter the microenvironment of tumor cell. Further studies have to be performed for conclusive evidence.

The emergence and spread of multidrug-resistant (MDR) pathogenic bacteria is a clinical problem that requires novel anti-infective agents. Targeting pathogenic biofilms is considered a promising strategy to control bacterial infections. In this study, bioactive extracts of

Buckwheat breads enriched with seeds (e.g., poppy, carum, amaranth, sunflower, and pumpkin) and nuts can be excellent sources of selected macro- and microelements and bioactive components, such as phenolics, essential oils, unsaturated fatty acids, fiber, and vitamins, however, no studies described their impacts on body biochemical parameters and antioxidant status. The aim of this study was to a determine the safety (the analyses of blood morphological and biochemical parameters) of short-term diets based on buckwheat breads supplemented with the commonly used functional ingredients. Additionally, we confirmed the usefulness of these fortified breads in a reduction of blood cholesterol and triacylglycerols, as well as an improvement of in vivo antioxidant status of Wistar rats. Enriched breads presented an increased phenolic content, however, it has not been translated into an elevation of antioxidant capacities. During short-term in vivo experiments, the studied breads increased the body mass of the rats, except the control buckwheat bread. Compared to the control, the poppy-milk bread markedly lowered (&ndash, 23%) and egg yolk&ndash, carum bread significantly increased (+17%) the total cholesterol concentration in serum. All the fortified breads decreased triacylglycerols&rsquo, levels by about 50%. Bread enriched with the poppy&ndash, milk, milk-seed, egg yolk&ndash, carum, and a mix of additives decreased superoxide dismutase activity by 68%, 66%, 73%, and 71%, respectively. Catalase activity was significantly decreased in the rats fed with carum bread (&ndash, 62%) and markedly increased in the groups fed with egg yolk&ndash, carum bread (+89%), hazel nuts&ndash, amaranth bread (+72%), and milk&ndash, seeds bread (+65%). The results confirmed the usefulness and safety of functional additives in buckwheat breads.

Background Polycystic ovary syndrome (PCOS) is a common endocrine disorder. The aim of the present study was to evaluate the effects of the oral administration of thylakoid-rich spinach extract and the caraway aqueous extract in letrozole-induced polycystic ovary syndrome rats. Methods Sixty female Sprague-Dawley rats were randomly divided into five groups of 12 animals each. Letrozole (1 mg/kg) was administered orally for a period of 28 days to induce PCOS. Sham and PCOS control rats received 1 mL/day of distilled water, and the three groups of PCOS rats were given 150 mg/kg of metformin, 3 g/kg of caraway, and thylakoid at a dose of 6 mg chlorophyll/gr food intake/day by oral gavage for 8 weeks. Finally, blood samples were collected and the right ovary of rats was removed, weighed, and fixed in 4% buffered formalin to determine the biochemical and stereological parameters. Results Compared to the PCOS control group, consuming metformin, thylakoid, and caraway extracts significantly improved the fasting blood sugar (FBS), tumor necrosis factor-alpha (TNF-α), malondialdehyde (MDA), luteinizing hormone (LH), insulin resistance, and body weight, increased the volume of the corpus luteum, and reduced the number of atretic follicles after 8 weeks (푃P Conclusion Our data showed that the consumption of thylakoid and caraway extracts for 8 weeks may have beneficial effects on the biochemical and stereological factors in PCOS-induced rats.

The article focuses on lexical relations of the Finnic languages. Here we studied whether lexical data is suitable for detecting the coarse-grained and fine-grained substructure within the Finnic group. We evaluated this by clustering old lexical variation from a dialectal dataset covering the whole Finnic speaker area (Atlas Linguarum Fennicarum; ALFE) using quantitative methods adopted from population genetics, and by comparing our results to groups suggested by earlier linguistic literature. We found the main lexical division between north-eastern and south-western Finnic. According to our lexical analysis, the Finnic languages are Finnish, North Estonian, South Estonian, Livonian, Karelian, Veps, and Votic-Ingrian. These groups matched well with the earlier suggested divisions, and we concluded that lexical data could be utilised more often in defining linguistic sub-structures, especially in linguistic situations that involve dialect continua.

Background Herbs are rich in various beneficial bioactive compounds and they can be used for many different purposes. One of the most common is maceration of herbs in alcohol. Different substances respond differently to extraction in prepared solutions. It is very important to enhance the highest proportion of beneficial ingredients during the maceration process in a herbal liqueur. A comparative analysis of numerous different phenolic compounds from eight of the most frequently used herbs for making aperitifs in Europe was performed. Results In the comparison among all studied herbs, the highest phenolic content was found with Artemisia absinthium (wormwood) (14.61 mg g-1 ) and Mentha piperita (peppermint) (13.89 mg g-1 ), while the lowest content was found with Centaurium erythraea (common centaury) (3.96 mg g-1 ). Salvianolic acid isomers and caffeic acid derivatives were the greatest contributors to the total phenolic content in lemon balm, wormwood, peppermint, fennel and sage. These compounds contain more hydroxyl groups and they were better extracted at the beginning of the maceration process. Caraway and common centaury contain more flavonols (quercetin and kaempferol derivatives), with higher chemical stability and fewer hydroxyl groups in their structure. Conclusion The compositions of eight herbal liqueurs were highly related to the presence of different herbal ingredients and their solubility in the extract over time. Most flavonol derivatives were extracted over a longer time and the two liqueurs (common centaury and caraway) therefore had the highest phenolic contents after 3 weeks of maceration. © 2019 Society of Chemical Industry.

Medicinal plants have been identified and used as primary sources in prevention and treatment of pulmonary diseases (mainly obstructive pulmonary diseases) from ancient times due to various pharmacological activities. In this review, the stimulatory effects of extracts, some fractions and constituents of medicinal plants on β2-adrenoceptors which could be used as possible therapeutic agents in the future were reviewed. Various databases including; Medline, PubMed, ScienceDirect, Scopus, and Google Scholar were searched using stimulatory effect, β2-adrenoceptors, possible mechanism, tracheal smooth muscle (TSM), medicinal plants and their constituents as keywords from 1985 to 2017. All studied plants including; Nigella sativa, Rosa damascena, Thymus vulgaris, Carum copticom, Carum carvi, Zataria multiflora, Crocus sativus, Cuminum cyminum, Liomnia acidissima, Portulaca oleraceae, Satureja hortensis, Ephedra sinica and Achillea millefolium showed relaxant effect on tracheal smooth muscle with a stimulatory effect on β2-adrenoceptors mechanism. The studied plants and their constituents could be of therapeutic value in clinical practice as a bronchodilatory drug by β2-adrenoceptors stimulatory mechanism for treatment of obstructive pulmonary diseases.

BACKGROUND AND OBJECTIVE Medicinal herbs and aromatic plants could be used to manipulate rumen fermentation. This study aimed to evaluate the effect of adding herbal and aromatic plants at 1, 3, 5, 7% of total ratio DM supplementation of the incubation media of an in vitro rumen model. MATERIAL AND METHODS About 400±4 mg of feed sample (roughage and concentrate ratio of 45:55%) with each level, weighted into 125 mL glass bottles (6 bottles for each treatment), rumen fluid injected into these bottles and incubated at 39°C, after 24 h incubation digestibility of dry matter (IVDMD) and organic matter digestibility (IVOMD), total gas production (TG) and metabolic energy (ME) were studied. RESULTS The differences among plants, added at different levels, were significant. Significant differences were also observed between highest level added compared with control in ammonia (NH3) and volatile fatty acids (VFA), IVDMD and IVOMD compared with control. Total gas (TG) was significantly higher at level 7%, especially with added Melissa compared with other plants. Metabolic energy (ME), was significantly higher in all treatments compared with control. CONCLUSION It may be concluded that addition of different medicinal and aromatic herbal plants Caraway (Carum carvi), fennel (Foeniculum vulgare) and Melissa (Melissa officinali)), especially at highest levels tested has a great potential in manipulating rumen fermentation, which may be of benefit when applied in ruminant nutrition.

Scientists are attempting to find novel methods to overcome cancers. Nanoemulsion systems as the novel drug delivery tools have been widely used in cancer therapy. In this study, the Carum Carvi oil nanoemulsions (CCONE) were prepared and its cytotoxic activity was studied on human colon cancer HT-29 cells using MTT assay. Flow cytometry and Real-time qPCR were triggered to evaluate the nanoemulsions' apoptotic properties. The results showed a significant negative association between the HT-29 cancer cell viability and CCONE doses of treatments compared with Huvec normal cells (p value