774 results on '"Xing, Pei"'
Search Results
202. Multicenter Study on Observation of Acute-phase Responses After Infusion of Zoledronic Acid 5 mg in Chinese Women with Postmenopausal Osteoporosis
- Author
-
Yue, Ding, Jian-Cheng, Zeng, Fei, Yin, Chun-Lin, Zhang, Yan, Zhang, Shi-Xun, Li, Xun, Liu, Chao, Zhang, Qing-Yun, Xue, Hua, Lin, and Fu-Xing, Pei
- Subjects
China ,Bone Density Conservation Agents ,Diphosphonates ,Incidence ,Anti-Inflammatory Agents, Non-Steroidal ,Imidazoles ,Pain ,Middle Aged ,Zoledronic Acid ,Product Surveillance, Postmarketing ,Clinical Articles ,Humans ,Female ,Acute-Phase Reaction ,Infusions, Intravenous ,Osteoporosis, Postmenopausal ,Aged - Abstract
OBJECTIVE: It has been reported that acute‐phase reactions (APR) after infusion of 5 mg zoledronic acid for the first time is common. This study surveyed the incidence and characteristics of APR in Chinese postmenopausal women receiving 5 mg zoledronic acid intravenously for osteoporosis and to evaluate the efficacy of non‐steroidal anti‐inflammatory drugs (NSAID) in preventing or alleviating APR following the first 5 mg zoledronic acid infusion. METHODS: A total of 2601 patients with an average age of 68.14 ± 9.89 years and a mean body mass index of 22.90 ± 3.24 kg/m(2) from 62 centers in China were treated with 5 mg zoledronic acid intravenously for the first time. The incidence of fever and pain were observed in these patients, and the time of fever or pain onset and duration, and the intensity of fever and grade of pain were also recorded. The dosage, duration, and efficacy of NSAID and safety outcomes were also documented. RESULTS: At the end of the study, 18 patients are eliminated due to incomplete records of temperature. The incidence of fever was 28.65% (740/2583) within 7 days following zoledronic acid infusion; 98.34% (727/740) occurred at 1.03 ± 0.66 days after infusion and lasted 1.72 ± 0.93 days. A total of 456 (17.53%) patients had newly onset pain (312 of 1187, 26.28%) or experienced pain aggravation (144 of 1414, 10.18%), which mostly occurred within 3 days after zoledronic acid infusion. A total of 1246 (47.6%) patients had received NSAID for a median time of 2.63 ± 2.45 days. Using NSAID for at least 2 days could decrease body temperature by 0.54 ± 0.86°C, increase the percentage of pain‐free patients by 6.17%, and reduce the percentage of patients with moderate to severe pain by 8.7%. CONCLUSIONS: Compared with Western populations, Chinese patients had a higher rate of fever and pain after their first zoledronic acid infusion. These symptoms were often mild to moderate in intensity and transient in duration. NSAID could effectively reduce the incidence and severity of such APR.
- Published
- 2017
203. Ag3PO4 nanocrystals deposited on monoclinic olive-like BiVO4 with efficient photodegradation of organic dyes under visible light irradiation
- Author
-
Shengyi Zhang, Liang-Liang Jiang, Chang-Jie Mao, Jiming Song, Jingshuai Chen, Xing-Pei Liu, and Helin Niu
- Subjects
Materials science ,Scanning electron microscope ,Bioengineering ,02 engineering and technology ,General Chemistry ,010402 general chemistry ,021001 nanoscience & nanotechnology ,Condensed Matter Physics ,Photochemistry ,01 natural sciences ,Atomic and Molecular Physics, and Optics ,0104 chemical sciences ,chemistry.chemical_compound ,chemistry ,Transmission electron microscopy ,Modeling and Simulation ,Rhodamine B ,Photocatalysis ,General Materials Science ,0210 nano-technology ,High-resolution transmission electron microscopy ,Photodegradation ,Monoclinic crystal system ,Visible spectrum - Abstract
Olive-like BiVO4 microstructures with lengths of 600–1000 nm and widths of 300–600 nm have been synthesized via a facile and additive-free solvothermal method. Studies find that the type of solvent plays an important role in the morphology of the final products. Furthermore, Ag3PO4 nanocrystals are successfully deposited on monoclinic olive-like BiVO4 via in situ precipitation method. The as-synthesized samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), photoluminescence (PL) spectra, and UV–vis diffuse reflectance spectra (DRS). The photocatalytic activities of the catalysts are evaluated by degradation of rhodamine B (RhB) and methylene blue (MB) under visible light (≥420 nm) irradiation. The experimental results suggest that catalytic activity of the composite photocatalysts is greatly influenced by the loading level of Ag3PO4. The molar ratio of 0.8:1.0 Ag3PO4-loaded BiVO4 exhibits higher photocatalytic activity in both the decolorization of RhB and MB than that of individual BiVO4 and P25. The observed improvement in photocatalytic activity is associated with the extended absorption in the visible light region resulting from the Ag3PO4 nanoparticles, and the effective separation of photogenerated carriers at the Ag3PO4/BiVO4 interfaces through the formation of heterojunction structure. The study provides a general and effective method in the fabrication of composite with sound heterojunctions that may show a variety of applications.
- Published
- 2017
204. Formation and evolution of a pair of collisionless shocks in counter-streaming flows
- Author
-
Yongkun Ding, Bo Han, Yutong Li, Suming Weng, Kai Du, Guiyun Liang, J. Zhao, Huigang Wei, Feilu Wang, Jiayong Zhong, Yan-Fei Li, Meng Liu, Yingjun Li, Jianqiang Zhu, Dawei Yuan, Baojun Zhu, Baoqiang Zhu, Gang Zhao, Zhe Zhang, Xiao-Xing Pei, Fang Li, Jie Zhang, and Shaoen Jiang
- Subjects
Physics ,Multidisciplinary ,Offset (computer science) ,Mechanics ,Laser ,01 natural sciences ,Article ,010305 fluids & plasmas ,law.invention ,Physics::Plasma Physics ,law ,Electric field ,Excited state ,0103 physical sciences ,Thermal ,010306 general physics ,Laser beams ,Pressure gradient ,Positive feedback - Abstract
A pair of collisionless shocks that propagate in the opposite directions are firstly observed in the interactions of laser-produced counter-streaming flows. The flows are generated by irradiating a pair of opposing copper foils with eight laser beams at the Shenguang-II (SG-II) laser facility. The experimental results indicate that the excited shocks are collisionless and electrostatic, in good agreement with the theoretical model of electrostatic shock. The particle-in-cell (PIC) simulations verify that a strong electrostatic field growing from the interaction region contributes to the shocks formation. The evolution is driven by the thermal pressure gradient between the upstream and the downstream. Theoretical analysis indicates that the strength of the shocks is enhanced with the decreasing density ratio during both flows interpenetration. The positive feedback can offset the shock decay process. This is probable the main reason why the electrostatic shocks can keep stable for a longer time in our experiment.
- Published
- 2017
205. Second-generation monoclonal antibodies to intestinal MUC2 peptide reactive with colon cancer
- Author
-
Xing, Pei-Xiang, Prenzoska, Julie, Layton, Guy T., Devine, Peter L., and McKenzie, Ian F.C.
- Subjects
Antineoplastic antibiotics -- Physiological aspects ,Colorectal cancer -- Physiological aspects ,Peptides -- Synthesis ,Health - Abstract
Background: Antitumor antibodies have traditionally been made to whole tumors or tumor extract. The use of defined synthetic antigens would be desirable for producing monoclonal antibodies. Purpose: Our purpose was to determine if antipeptide antibody to MUC2 had antitumor activity and specificity. Methods: A 29-amino-acid peptide to MUC2 was synthesized and monoclonal antibodies were produced after immunizing BALB/c mice with peptide-keyhole-limpet hemocyanin in complete Freund's adjuvant, and the monoclonal antibodies were tested on peptides and human tissues. Results: CCP31, CCP37, and CCP58 monoclonal antibodies were produced using MUC2 MI-29 (KYPTTTPISTTTMVTPTPTPTGTQT-PTTT) containing one repeat unit of 23 amino acids and part of the next repeat of four amino acids. These antibodies reacted with the MUC2-derived peptide but not with MUC1- or MUC3-derived peptides. One of the monoclonal antibodies, CCP58, reacted strongly with human colon cancer and normal intestine in both fresh and formalin-fixed tissues; two other antibodies, CCP37 and CCP31, reacted only with fresh human tissues of normal colon and malignant colon tumors by immunoperoxidase staining. In addition, CCP37 and CCP58 reacted strongly with human gastric cancer; all antibodies reacted weakly with human salivary gland, and none reacted with tissues from normal human lung, kidney, stomach, pancreas, or endometrium. By analysis of mucin molecules by Western blotting, the antigen detected by monoclonal antibodies CCP37 and CCP58 was found to be of a high relative molecular mass (520 kd). Conclusions: Anti-MUC2 peptide antibodies appear to be relatively tissue specific and represent a new method of producing antitumor antibodies. [J Natl Cancer Inst 84:699-703, 1992]
- Published
- 1992
206. Stochastic Resonance in a Complex Nonlinear System Driven by Complex Periodic Signal and Noise
- Author
-
Yun Liang Meng, Dong Wu Li, and Chang Xing Pei
- Subjects
Physics ,Noise (signal processing) ,Stochastic resonance ,General Medicine ,Periodic function ,Nonlinear system ,symbols.namesake ,Amplitude ,Control theory ,Gaussian noise ,Nonlinear resonance ,symbols ,Statistical physics ,Signal transfer function - Abstract
The phenomenon of stochastic resonance in a complex nonlinear system which is excited by both complex weak periodic signal and noise is investigated in this paper. The model of complex nonlinear system is given, and the effects of the input periodic signal amplitude and the noise intensity on the response amplitude of the system at the periodic signal frequency are discussed through numerical simulations. It is shown that the response amplitude of the system to the input periodic signal displays a non-monotonic dependence on the noise intensity, and the response peaks at a particular value of the noise intensity, which is known as stochastic resonance. The results in this paper propose a new way for controlling stochastic resonance in a complex nonlinear system.
- Published
- 2014
207. Optimum Vibrational Resonance in a Time-Delay Bistable System Driven by Biharmonic Signals
- Author
-
Dong Wu Li, Yun Liang Meng, and Chang Xing Pei
- Subjects
Physics ,Amplitude ,Bistability ,Control theory ,Biharmonic equation ,Response Amplitude ,Vibrational resonance ,General Medicine ,Atomic physics ,Low frequency ,Signal - Abstract
The optimum vibrational resonance in a time-delay bistable system driven by bihiarmonic signals is discussed in this paper. The theoretically expression for the response amplitude gain of low frequency signal in the time-delay bistable system is deduced, and the effects of time delay parameter on the optimum vibrational resonance peak and the required amplitude of high frequency signal are investigated. It is shown that the optimum vibrational resonance can be achieved by adjusting the high frequency signal amplitude and time delay parameter jointly. Meanwhile, the optimum vibrational resonance appeared periodically with time delay parameter and the period is equal to the period of low-frequency signal. The amplitude of high-frequency signal required for the optimum vibrational resonance can be fixed or varied with different time delay parameter depending on the ratio of the frequencies between biharmonic signals.
- Published
- 2014
208. An Interference Cancellation Space-Time RAKE Receiver in Asynchronous Cooperative Communications Systems
- Author
-
Dong Wu Li, Chang Xing Pei, and Yun Liang Meng
- Subjects
Engineering ,business.industry ,Rake ,General Medicine ,Antenna diversity ,Single antenna interference cancellation ,Interference (communication) ,Asynchronous communication ,Electronic engineering ,Bit error rate ,Rake receiver ,business ,Multipath propagation ,Computer Science::Information Theory - Abstract
Space-time two dimensional RAKE receiver was introduced into asynchronous and cooperative communication system, and a high-performance RAKE receiving algorithm was proposed. In this algorithm, the transmitting signals were estimated coarsely by traditional space-time rake receiver, then each multipath signal was reconstructed using the estimated result as well as the channel impulse response, and then eliminated successively from reception signals, so it can eliminate Inter Symbol Interference of receiver signals which generate by multipath fading, and the line of sight (LOS) component in the received signal was obtained, and finally, the space-time combination was carried out to the LOS component, and the spatial diversity was achieved. This algorithm can effectively reduce the bit error rate of the asynchronous cooperative communication system. Simulation result shows that the new algorithm can improve the performance of traditional space-time RAKE when SNR is higher than 5dB dramatically.
- Published
- 2014
209. Disposable Copper-Based Electrochemical Sensor for Anodic Stripping Voltammetry
- Author
-
William R. Heineman, Wenjing Kang, Ian Papautsky, Wei Yue, Adam Bange, and Xing Pei
- Subjects
Point-of-Care Systems ,Analytical chemistry ,chemistry.chemical_element ,02 engineering and technology ,Zinc ,Electrochemistry ,01 natural sciences ,Article ,Analytical Chemistry ,Blood serum ,Lab-On-A-Chip Devices ,Animals ,Electrodes ,010401 analytical chemistry ,Serum Albumin, Bovine ,021001 nanoscience & nanotechnology ,Copper ,0104 chemical sciences ,Electrochemical gas sensor ,Anodic stripping voltammetry ,chemistry ,Electrode ,Microtechnology ,Cattle ,0210 nano-technology ,Platinum - Abstract
In this work, we report the first copper-based point-of-care sensor for electrochemical measurements demonstrated by zinc determination in blood serum. Heavy metals require careful monitoring, yet current methods are too complex for a point-of-care system. Electrochemistry offers a simple approach to metal detection on the microscale, but traditional carbon, gold (Au), or platinum (Pt) electrodes are difficult or expensive to microfabricate, preventing widespread use. Our sensor features a new low-cost electrode material, copper, which offers simple fabrication and compatibility with microfabrication and PCB processing, while maintaining competitive performance in electrochemical detection. Anodic stripping voltammetry of zinc using our new copper-based sensors exhibited a 140 nM (9.0 ppb) limit of detection (calculated) and sensitivity greater than 1 μA/μM in the acetate buffer. The sensor was also able to determine zinc in a bovine serum extract, and the results were verified with independent sensor measurements. These results demonstrate the advantageous qualities of this lab-on-a-chip electrochemical sensor for clinical applications, which include a small sample volume (μL scale), reduced cost, short response time, and high accuracy at low concentrations of analyte.
- Published
- 2014
210. Comparison of three different tourniquet application strategies for minimally invasive total knee arthroplasty: a prospective non-randomized clinical trial
- Author
-
Bin Shen, Fu Xing Pei, Z. Zhou, Peng De Kang, Jun Ma, Zeyu Huang, and Jing Yang
- Subjects
Male ,medicine.medical_specialty ,medicine.medical_treatment ,Blood Loss, Surgical ,Hematocrit ,law.invention ,Hemoglobins ,Postoperative Complications ,Randomized controlled trial ,law ,Osteoarthritis ,Humans ,Minimally Invasive Surgical Procedures ,Medicine ,Orthopedics and Sports Medicine ,Prospective Studies ,Arthroplasty, Replacement, Knee ,Prospective cohort study ,Aged ,Tourniquet ,medicine.diagnostic_test ,business.industry ,General Medicine ,Middle Aged ,Tourniquets ,equipment and supplies ,Arthroplasty ,Hemostasis, Surgical ,Surgery ,body regions ,surgical procedures, operative ,Hemostasis ,Orthopedic surgery ,Cytokines ,Female ,business ,Range of motion - Abstract
It is still controversial on the optimal timing of tourniquet used in total knee arthroplasty (TKA). Most previous studies focused on the comparison of different tourniquet application in controversial TKA, while the aim of our work was to compare three strategies of tourniquet application in minimally invasive TKA. 90 patients were enrolled in this study. Based on the different tourniquet application strategies, they were divided into three groups. Group A: using tourniquet during the whole surgery; Group B: tourniquet inflated before incision and deflated after the hardening of the cement; Group C: using tourniquet during the cementation. Blood loss and serum levels of C-reactive protein, IL-6, creatine kinase and myoglobin were checked preoperatively. The HSS knee score, VAS pain score, range of motion (ROM), limb swelling and hospital stays were also recorded. The mean levels of Hb and Hct were lower in Group C (104.2 ± 10.4 g/L, 31.8 ± 3.2 %) than those in Groups A (111.4 ± 14.4 g/L, p = 0.035; 34.1 ± 4.1 %, p = 0.032) and B (112.8 ± 14.3 g/L, p = 0.013; 34.5 ± 3.7 %, p = 0.011) immediately after the surgery. Compared with Groups A and B, both serum inflammation and muscle damage markers were lower in Group C. There were no significant differences between the groups in terms of HSS knee score, ROM, estimated blood loss, swelling ratio, VAS pain score and hospital stays. Using a tourniquet full time in minimally invasive TKA causes less intraoperative blood loss and more excessive inflammation and muscle damage. However, the advantage of part-time using tourniquet did not show in early functional outcomes.
- Published
- 2014
211. Study on irregular spherical latticed roof of silo
- Author
-
Xian-Cheng Wang, Peng Su, Meng-Yang Zhang, Xing-Pei Liang, and Fang Yuan
- Subjects
business.industry ,Silo ,Structural engineering ,business ,Roof ,Geology - Published
- 2016
212. CPP-Assisted Intracellular Drug Delivery, What Is Next?
- Author
-
Zhili Yu, Junbo Gong, Xing Pei, Victor C. Yang, Junxiao Ye, Ergang Liu, Sunhui Chen, Pengwei Zhang, Huining He, and Meong Cheol Shin
- Subjects
0301 basic medicine ,Drug ,intracellular delivery ,media_common.quotation_subject ,Normal tissue ,Antineoplastic Agents ,02 engineering and technology ,Review ,Cell-Penetrating Peptides ,Pharmacology ,Biology ,Organ distribution ,Catalysis ,Permeability ,Inorganic Chemistry ,lcsh:Chemistry ,03 medical and health sciences ,Neoplasms ,Animals ,Humans ,Tissue Distribution ,Tissue distribution ,Physical and Theoretical Chemistry ,Molecular Biology ,lcsh:QH301-705.5 ,Spectroscopy ,media_common ,pH and enzyme triggered drug delivery system ,Drug Carriers ,Organic Chemistry ,CPPs ,General Medicine ,Hydrogen-Ion Concentration ,021001 nanoscience & nanotechnology ,Endocytosis ,Computer Science Applications ,030104 developmental biology ,lcsh:Biology (General) ,lcsh:QD1-999 ,Cancer research ,Intracellular drug delivery ,0210 nano-technology ,Drug carrier ,Cell penetration - Abstract
For the past 20 years, we have witnessed an unprecedented and, indeed, rather miraculous event of how cell-penetrating peptides (CPPs), the naturally originated penetrating enhancers, help overcome the membrane barrier that has hindered the access of bio-macromolecular compounds such as genes and proteins into cells, thereby denying their clinical potential to become potent anti-cancer drugs. By taking the advantage of the unique cell-translocation property of these short peptides, various payloads of proteins, nucleic acids, or even nanoparticle-based carriers were delivered into all cell types with unparalleled efficiency. However, non-specific CPP-mediated cell penetration into normal tissues can lead to widespread organ distribution of the payloads, thereby reducing the therapeutic efficacy of the drug and at the same time increasing the drug-induced toxic effects. In view of these challenges, we present herein a review of the new designs of CPP-linked vehicles and strategies to achieve highly effective yet less toxic chemotherapy in combating tumor oncology.
- Published
- 2016
213. An adaptive quantum state-hopping communication strategy based on kangaroo entanglement hopping model
- Author
-
Ai-Jing Sun, Zhang Meiling, Min Nie, Chang-xing Pei, Rongyu Wei, and Guang Yang
- Subjects
Physics ,Quantum state ,Quantum mechanics ,General Physics and Astronomy ,Quantum entanglement - Abstract
Quantum communication in free space will be disturbed by natural environment such as fog and dust. However, to build a global quantum satellite wide area communication network, we must solve the problem of 24-h all-weather communication between satellite and earth. With the evolution of time, the degree of interference becomes deeper. In order to improve the performance of quantum communication under such an interference, in this paper we analyze the change of single quantum state channel over time under the background interference, and propose an quantum state-hopping communication strategy based on the kangaroo entanglement hopping model (KEHM), and simulate the performance and parameters of the strategy. Kangaroos are social animals. When they are frightened, they will jump synchronously in the same way with the same step length, height and frequency. According to this model, we make the two communicating parties realize synchronous quantum state jump according to the prearranged pattern. The simulations show that when the ratio between the average power of background quantum noise and the average power of quantum signal is 5, the quantum bit error rate decreases from 0.4524 to 0.1116 with the quantum state hopping frequency increasing from 1 to 15. When the single quantum state transmission success rate is 0.95 and the quantum bit rate is greater than 200 qubit/s, the probabilities of successful transmission of quantum bits at different state hopping frequencies are greater than 0.97. When the quantum reception efficiency of the receiver is 0.8, the quantum state pass rate increases from 0.3667 to 0.9986 with the average quantum number of the source increasing from 1 to 10. When the average quantum number of the source is 6, the passing rate of quantum state increases from 0.6262 to 0.9855 with the quantum receiving efficiency of the receiver increasing from 0.2 to 0.99. However, if the average quantum number of the transmitter is large enough and the receiving efficiency of the receiver is close to 1, the passing rate of the quantum state is also close to 1. The adaptive control strategy of quantum state hopping is based on real-time quantum channel state detection. Its core idea is to remove the quantum states which are seriously disturbed from the quantum state hopping set, and to realize the synchronous hopping of communication parties on the quantum states with low interference. Adopting the strategy of quantum state hopping adaptive control can further reduce the quantum bit error rate of the system. The error rate gain of adaptive control system increases with the increase of the success probability of processing the disturbed quantum state. When the probability of processing the disturbed quantum state is 0.95, the system error rate gain can reach 1.301. The performance of quantum state hopping system is improved obviously. To sum up, the adaptive quantum state-hopping communication strategy based on the kangaroo entanglement hopping model proposed in this paper greatly enhances the comprehensive immunity of the system and ensures the security of quantum information network, and provides an important reference for the healthy development of wide-area quantum satellite communication network in the future.
- Published
- 2019
214. Gammaherpesvirus infection and malignant disease in rhesus macaques experimentally infected with SIV or SHIV
- Author
-
Marshall, Vickie A., primary, Labo, Nazzarena, additional, Hao, Xing-Pei, additional, Holdridge, Benjamin, additional, Thompson, Marshall, additional, Miley, Wendell, additional, Brands, Catherine, additional, Coalter, Vicky, additional, Kiser, Rebecca, additional, Anver, Miriam, additional, Golubeva, Yelena, additional, Warner, Andrew, additional, Jaffe, Elaine S., additional, Piatak, Michael, additional, Wong, Scott W., additional, Ohlen, Claes, additional, MacAllister, Rhonda, additional, Smedley, Jeremy, additional, Deleage, Claire, additional, Del Prete, Gregory Q., additional, Lifson, Jeffrey D., additional, Estes, Jacob D., additional, and Whitby, Denise, additional
- Published
- 2018
- Full Text
- View/download PDF
215. Photoelectrochemical immunoassay for human interleukin 6 based on the use of perovskite-type LaFeO3 nanoparticles on fluorine-doped tin oxide glass
- Author
-
Liu, Xing-Pei, primary, Xie, Xing-Li, additional, Wei, Yu-Ping, additional, Mao, Chang-jie, additional, Chen, Jing-Shuai, additional, Niu, He-Lin, additional, Song, Ji-Ming, additional, and Jin, Bao-Kang, additional
- Published
- 2017
- Full Text
- View/download PDF
216. Distinction of the Property of Low Frequency Oscillation Based on ARMA Mode Identification
- Author
-
Chun Li Song, Qing Fen Liao, Di Chen Liu, Xing Pei Ji, Tu Lian, Zhen Shan Zhu, and Fei Fei Dong
- Subjects
Recursive least squares filter ,Damping ratio ,Oscillation ,Control theory ,Mode (statistics) ,Autoregressive–moving-average model ,General Medicine ,Low frequency ,Type (model theory) ,Low-frequency oscillation ,Mathematics - Abstract
Aiming at how to solve the question of quantitatively distinguish negative damping low frequency oscillation and forced power oscillation, the difference in frequency and damping ratio between the two kinds of oscillations have been discovered through mechanism analysis, and a new quantitative distinction criterion for the property of the low frequency is proposed. The oscillation data is windowing identified by ARMA model based on weighted recursive least squares algorithm dynamically, and low frequency type can be distinguished according to the changes of oscillation frequency and damping ratio during the oscillation. The simulative results have shown that the method is feasible and effective.
- Published
- 2013
217. Numerical Analysis of the Vibration of Pipes Conveying Fluid under the Influence of Vertical Branch
- Author
-
Zheng Zhou, Xiao Yang Wang, and Xing Pei Liu
- Subjects
Vibration ,Mechanism (engineering) ,Engineering ,business.industry ,Numerical analysis ,Nonlinear vibration ,General Engineering ,Structural engineering ,Galerkin method ,business - Abstract
Nonlinear vibration damage of pipes conveying fluid is a major problem in today’s production and life. Enormous economic loses and safety hazards were caused by nonlinear vibration. Pipes conveying fluid with various branches are very common in actual engineering. Their mechanical properties and vibration mechanism is quite different from that of pipes conveying fluid without branches. This paper showed the nonlinear vibration mechanism of pipes conveying fluid with vertical branches and nonlinear vibration damage factors. Nonlinear vibration theory was used to check the pipeline and some reference data for the rational selection of working parameters were provided.
- Published
- 2013
218. Reaction of Antibodies to Human Milk Fat Globule(HMFG) with Synthetic Peptides
- Author
-
Xing, Pei X., Reynolds, Kerry, Tjandra, Joe J., Tang, Xi L., Purcell, Damian F. J., McKenzie, Ian F. C., and Ceriani, Roberto L., editor
- Published
- 1989
- Full Text
- View/download PDF
219. Highly Sensitive Electrochemical Dopamine Sensor from Poly(diallyldimethylammonium chloride)-Functionalized Graphene Nanoribbon/Gold Nanoparticle Nanocomposite
- Author
-
Chang-Jie Mao, Jun Tong, He-Lin Niu, Baokang Jin, Shengyi Zhang, Zheng Yuan, Xing-Pei Liu, and Ying Yang
- Subjects
Detection limit ,Nanocomposite ,Materials science ,Graphene ,010401 analytical chemistry ,Biomedical Engineering ,Nanoparticle ,Bioengineering ,General Chemistry ,010402 general chemistry ,Condensed Matter Physics ,Electrochemistry ,01 natural sciences ,0104 chemical sciences ,Electrochemical gas sensor ,law.invention ,Dielectric spectroscopy ,Chemical engineering ,law ,General Materials Science ,Cyclic voltammetry - Abstract
A novel graphene oxide nanoribbon/poly(diallyldimethylammonium chloride)/gold nanoparticle (GONR/PDDA/AuNP) nanocomposite was synthesized successfully and used for the sensitive detection of dopamine. The GONR/PDDA/AuNP nanocomposite was characterized by transmission and scanning electron microscopy. The electrochemical sensor based on GONR/PDDA/AuNP nanocomposite. was studied by cyclic voltammetry and electrochemical impedance spectroscopy. Experimental parameters such as GONR/PDDA concentration, volume ratio of GONR/PDDA to AuNP, scan rates, and pH were studied to investigate their effect on peak currents. Under optimal conditions, the GONR/PDDA/AuNP-based sensor exhibited excellent electrocatalytic activity for the detection of dopamine with a wide linear range from 9.99 x 10(-8) to 8.69 x 10(-4) M and a low detection limit of 3.33 x 10(-8) M. Moreover, the proposed sensor exhibits high sensitivity, good reproducibility, and stability, and could therefore potentially be applied in other bioanalytical systems.
- Published
- 2016
220. Impact of early cART in the gut during acute HIV infection
- Author
-
Suwanna Puttamaswin, Peter W. Hunt, Claire Deleage, Xing Pei Hao, W. Gregory Alvord, Joseph M. McCune, Jacob D. Estes, Jintanat Ananworanich, Leslie Johnston, David R. Morcock, Jeffrey D. Lifson, Jerome H. Kim, Alexandra Schuetz, Merlin L. Robb, Irini Sereti, Nittaya Phanuphak, James L. K. Fletcher, Timothy W. Schacker, Rungsun Rerknimitr, and Robin Dewar
- Subjects
0301 basic medicine ,Cart ,Lamina propria ,education.field_of_study ,business.industry ,T cell ,Population ,virus diseases ,Inflammation ,General Medicine ,medicine.disease ,Systemic inflammation ,03 medical and health sciences ,030104 developmental biology ,medicine.anatomical_structure ,parasitic diseases ,Immunology ,medicine ,Immunohistochemistry ,medicine.symptom ,business ,education ,Infiltration (medical) ,Research Article - Abstract
Early after HIV infection there is substantial depletion of CD4+ T cells in the gastrointestinal (GI) tract lamina propria (LP), with associated epithelial barrier damage, leading to microbial translocation and systemic inflammation and immune activation. In this study, we analyzed these early events in the GI tract in a cohort of Thai acute HIV-infected patients and determined the effect of early combination antiretroviral treatment (cART). HIV-uninfected and chronically and acutely HIV-infected patients at different Fiebig stages (I–V) underwent colonic biopsies and then received cART. Immunohistochemistry and quantitative image analysis were performed on cross-sectional and longitudinal colon biopsy specimens (day 0 to week 96) to measure GI tract damage (infiltration of polymorphonuclear cells), inflammation (Mx1, TNF-α), immune activation (Ki-67), and the CD4+ T cell population in the LP. The magnitude of GI tract damage, immune activation, and inflammation was significantly increased, with significantly depleted CD4+ T cells in the LP in all acutely infected groups prior to cART compared with HIV-uninfected control participants. While most patients treated during acute infection resolved GI tract inflammation and immune activation back to baseline levels after 24 weeks of cART, most acutely infected participants did not restore their CD4+ T cells after 96 weeks of cART.
- Published
- 2016
221. [Incidence and anatomic distribution of venous thromboembolism following primary total hip and knee arthroplasty: a prospective observational study]
- Author
-
Jin-Wei, Xie, Chen, Yue, Jun, Ma, Bin, Shen, Jing, Yang, Zong-Ke, Zhou, Peng-de, Kang, and Fu-Xing, Pei
- Subjects
Postoperative Complications ,Arthroplasty, Replacement, Hip ,Incidence ,Humans ,Prospective Studies ,Venous Thromboembolism ,Arthroplasty, Replacement, Knee - Abstract
To analyze the incidence and anatomic distribution of venous thrombosis after total hip and knee arthroplasty by using the data of the patients with primary total hip and knee replacement.From December 2013 to December 2014, total hip and knee arthroplasty were performed in 1 686 patients, of which 928 were THA and 758 were TKA. Before and after discharge, all patients were routinely performed double lower limb vein color Doppler ultrasound, the conventional use of anti fibrinolytic drugs, postoperative anticoagulation for 14 d. The types and distribution of thrombosis after operation were statistical analysis.Among 928 cases of primary total hip arthroplasty, there were 30 cases of thrombosis, 27 cases of isolated muscle vein thrombosis, followed by the involvement of the anterior or posterior tibial vein thrombosis, no central thrombosis. Among 758 cases of primary total knee arthroplasty, there were 87 cases of thrombosis, 81 cases peripheral thrombosis, 4 cases of thrombus of center type, the remaining 2 cases for mixed thrombus;74 patients with thrombosis involving a single vein, 65 cases involved muscle vein, 4 cases of femoral vein, 3 cases of posterior tibial vein, 2 cases of superficial vein; 13 cases of thrombosis involving multiple veins, involving muscle vein, posterior tibial veins, the peroneal veins and popliteal vein in 2 or 3 branches. The comparison results showed that the incidence of thrombosis after total knee arthroplasty was higher, the difference was statistically significant (The incidence of thrombosis in patients with primary hip and knee replacement is low, and the incidence and anatomic distribution of the patients with primary hip and knee replacement are different.
- Published
- 2016
222. [Reliability and Validity of Function Score for Adult Tibetans with Kashin Beck Disease in Aba Tibetan Autonomous Area in Sichuan Province]
- Author
-
Qiang, Huang, Zong-ke, Zhou, Jun, Ma, Bin, Shen, Peng-de, Kang, Jing, Yang, and Fu-xing, Pei
- Subjects
Adult ,Kashin-Beck Disease ,China ,Surveys and Questionnaires ,Activities of Daily Living ,Humans ,Reproducibility of Results ,Health Surveys ,Pain Measurement - Abstract
To validate the function score for adult Tibetans with Kashin-Beck disease (FSAT- KBD) measuring daily life and work functional status of KBD patients.From September to October 2010, 352 adult KBD patients in Rangtang County of Aba Tibetan autonomous region were invited to complete FSAT-KBD. The internal consistency of FSAT-KBD was assessed using Cronbach's alpha coefficients. Principal component analysis with varimax rotation was performed to explore factor structure of the instrument, with item-domain correlations being examined using Spearman's rank correlation tests. Discriminant validity of the FSAT-KBD was assessed by comparing scores of the respondents with different ages and different functional status. Convergent validity of the FSAT-KBD was assessed through a comparison with the medical outcomes study short form health survey (SF-12) and visual analogue scale (VAS).338 KBD patients (a response rate of 96.0%) completed the questionnaire in an average of (3.2 +/- 1.6) min. The instrument achieved a Cronbach's alpha of 0.945, with item-to-domain correlations exceeding 0.0. Two latent factors were extracted, which explained 72.8% of the total variance. The factor structure fitted well with our conceptual hypothesis. Respondents with different age, duration of suffering and number of affected joints had different FSAT-KBD scores. The FSAT-KBD results were correlated with those of SF-12 and VAS.FSAT-KBD is a reliable and valid instrument for measuring daily functional status of adult KBD patients in Aba Tibetan autonomous area in China.
- Published
- 2016
223. Laboratory astrophysics with laser-driven strong magnetic fields in China
- Author
-
Yan-Fei Li, Guiyun Liang, Si-Liang Zeng, Fang Li, Baojun Zhu, Yutong Li, Jie Zhang, Zhe Zhang, Huigang Wei, Jiayong Zhong, Shi-Yang Zou, Xiao-Xing Pei, Feilu Wang, Bo Han, Dawei Yuan, and Gang Zhao
- Subjects
Physics ,Shock wave ,Nuclear and High Energy Physics ,Magnetosphere ,Magnetic reconnection ,Plasma ,Astrophysics ,Laser ,01 natural sciences ,Atomic and Molecular Physics, and Optics ,010305 fluids & plasmas ,Electronic, Optical and Magnetic Materials ,law.invention ,Magnetic field ,Solar wind ,Nuclear Energy and Engineering ,law ,Beta (plasma physics) ,Physics::Space Physics ,0103 physical sciences ,010306 general physics - Abstract
In this paper, the recent studies of laboratory astrophysics with strong magnetic fields in China have been reviewed. On the Shenguang-II laser facility of the National Laboratory on High-Power Lasers and Physics, a laser-driven strong magnetic field up to 200 T has been achieved. The experiment was performed to model the interaction of solar wind with dayside magnetosphere. Also the low beta plasma magnetic reconnection (MR) has been studied. Theoretically, the model has been developed to deal with the atomic structures and processes in strong magnetic field. Also the study of shock wave generation in the magnetized counter-streaming plasmas is introduced.
- Published
- 2016
224. Reduced Inflammation and Lymphoid Tissue Immunopathology in Rhesus Macaques Receiving Anti–Tumor Necrosis Factor Treatment During Primary Simian Immunodeficiency Virus Infection
- Author
-
Jeremy Smedley, Mirko Paiardini, Levelle D. Harris, Rhonda MacAllister, Charles M. Trubey, W. Gregory Alvord, Jeffrey D. Lifson, Octavio A. Quiñones, David R. Morcock, Jacob D. Estes, Michael Piatak, Brian Tabb, Xing Pei Hao, Guido Silvestri, and Jason M. Brenchley
- Subjects
Male ,Chemokine ,T-Lymphocytes ,Anti-Inflammatory Agents ,Simian Acquired Immunodeficiency Syndrome ,Inflammation ,Biology ,Antibodies, Monoclonal, Humanized ,Lymphocyte Activation ,Proinflammatory cytokine ,Pathogenesis ,Random Allocation ,Immune system ,Cell Movement ,Immunopathology ,medicine ,Animals ,Immunology and Allergy ,Tumor Necrosis Factor-alpha ,Macrophages ,Adalimumab ,Viral Load ,Fibrosis ,Macaca mulatta ,CD4 Lymphocyte Count ,Retroviruses, Simian ,Infectious Diseases ,Gene Expression Regulation ,Immunology ,biology.protein ,Cytokines ,RNA, Viral ,Tumor necrosis factor alpha ,Lymph Nodes ,medicine.symptom ,Viral load - Abstract
(See the editorial commentary by Michael on pages 875–6.) Persistent immune activation is a hallmark of human immunodeficiency virus type 1 (HIV-1) infection in humans and simian immunodeficiency virus (SIV) infection in rhesus macaques. In progressive HIV/SIV infections, the level of immune activation has been demonstrated to be a stronger predictor of disease progression than either plasma viral load or peripheral CD4+ T-cell count [1, 2]. Acute infection is associated with the development of intense immune activation that remains abnormally high throughout the course of infection in the absence of antiretroviral treatment (ART). This persistent pathological immune activation is associated with elevated proinflammatory cytokine and coagulation markers that correlate with an increased risk of death among HIV-positive patients [3]. In SIV-infected monkeys and HIV-infected humans, early augmentation of proinflammatory cytokines and chemokines in lymphoid tissues may play a key role in modulating disease progression [4, 5]. Notably, early high expression of both proinflammatory and antiinflammatory molecules in lymphoid tissues has been proposed to contribute to enhanced immune activation, resulting in tissue damage rather than viral control, thus driving disease progression [4, 6]. Dissecting the elements of the acute inflammatory response that lead to chronic immune activation and disease progression may provide insights that can aid the development of specific adjunctive therapies that may limit inflammation-induced tissue damage and thereby improve the prognosis of HIV-infected individuals. The inflammatory response to infections reflects the aggregate effects of various cytokines and other soluble factors produced by multiple cellular populations. Tumor necrosis factor (TNF) has been identified as a key regulator and amplifier of inflammatory responses, with effects on the innate and adaptive immune systems [7–9]. TNF has been proposed to contribute to the overall pathogenesis of HIV/SIV infection, enhancing viral propagation, lymphocyte depletion, and clinical manifestations of disease. High TNF levels have been shown to be associated with all stages of HIV-1 infection, with increased TNF expression in the plasma and lymphoid tissues during acute HIV-1 infection [10, 11]. Sequential plasma samples collected during the eclipse and exponential viral expansion phases of acute HIV-1 infection demonstrated rapid and robust inflammatory responses, including early and sustained increases in TNF, that likely have immunopathological consequences by promoting immune activation, viral replication, and CD4+ T-cell loss [12]. In nonhuman-primate models, elevated TNF expression has been shown in the serum, peripheral blood mononuclear cells, lymph nodes, and brain of infected animals in temporal association with SIV replication during acute infection [13–15]. In contrast, studies of nonprogressive and apathogenic SIV infection in natural hosts of SIV have shown a lack of TNF upregulation throughout the acute and chronic stages of SIV infection [16], suggesting that differences in the host acute inflammatory response may be critically important in pathogenesis and disease progression. Since TNF inhibitors are used to treat a range of inflammatory conditions [17, 18], and given the data suggesting that TNF may play a key role in the acute inflammatory response to HIV/SIV infection, we evaluated the effect of anti-TNF antibody (adalimumab; Humira) treatment during the first 12 weeks of SIV infection in a small, nonhuman-primate study. While treatment did not affect viral replication dynamics or systemic T-cell activation profiles, inhibition of the biological activity of TNF reduced proinflammatory gene expression in lymphoid tissues during acute infection and attenuated antiinflammatory responses to SIV associated with pathological damage of lymphoid tissues [6]. Specifically, TNF blockade attenuated 3 manifestations of inflammation associated with SIV infection: (1) infiltration of CD163+ macrophages and neutrophils into the paracortical T-cell zone, (2) transforming growth factor β (TGF-β) expression in the T-cell zone, and (3) lymphoid tissue fibrosis, which was associated with less CD4+ T-cell loss, demonstrating that modulation of inflammatory responses to HIV/SIV infection may beneficially affect pathogenesis, independent of any direct effects on viral replication.
- Published
- 2012
225. Distributed Control System of Ceramic Material Kiln Based on MVC
- Author
-
Sheng Quan Yang, Bai Lin Liu, and Chang Xing Pei
- Subjects
Engineering ,Kiln ,business.industry ,Interface (computing) ,Frame (networking) ,ComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISION ,General Engineering ,ComputerApplications_COMPUTERSINOTHERSYSTEMS ,Control engineering ,Control theory ,Control system ,Graph (abstract data type) ,Distributed control system ,business ,Energy source ,Simulation - Abstract
The paper proposes and develops a distributed control system of ceramic material shuttle kiln control of MVC pattern based on the current ceramic material shuttle kiln control in which exist plenty of disadvantages such as wasting energy sources, low efficiency, bad precision and long periods, etc. Firstly, it introduces the basic theory and the system structure graph of the MVC pattern, and discusses in detail the design layer frame and structure characteristic of control system based on MVC pattern. Finally, under the environment of the Delphi, this paper illuminates the material realization of the MVC form of the total control system with adopting the multi-thread shared same buffer method. Practice development shows that the MVC pattern can separate easily the interface of operator and computer, operation logic and data disposal, which makes the total control system have the fluent trait, the spread trait and the easy maintenance trait.
- Published
- 2012
226. Embedded Capacitive Grid Sensing Technology for Torque Measurement
- Author
-
Dong Xing Pei, Rui Xie, Tie Hua Ma, and Hong Jin
- Subjects
Engineering ,Bearing (mechanical) ,business.industry ,Capacitive sensing ,General Engineering ,Grid ,Signal ,law.invention ,Transmission (telecommunications) ,law ,Electronic engineering ,Torque ,Torque sensor ,business ,Testability ,ComputingMethodologies_COMPUTERGRAPHICS - Abstract
Torque measurement of transmission shaft has problems such as signal transmission, limited installation space and signal disturbance. In this paper proposes an embedded capacitive grid torque sensor. Through a special installation the output of capacitive grid sensor is proportional to twist angle, then torque can be calculated. The two electrodes of capacitive grid sensor can be embedded into the bearing and shaft respectively that reduces installation space, to improve the testability of transmission shaft. Experiments show that capacitive grid sensor performs high reliability and is able to be used in the case of strict environmental requirements in long time.
- Published
- 2012
227. Solving the nonlinear Poisson-type problems with F-Trefftz hybrid finite element model
- Author
-
Qing-Hua Qin, Xing-Pei Liang, and Hui Wang
- Subjects
Dirichlet problem ,Partial differential equation ,Applied Mathematics ,Mathematical analysis ,General Engineering ,Mixed finite element method ,Boundary knot method ,Finite element method ,Split-step method ,Computational Mathematics ,Method of fundamental solutions ,Analysis ,Mathematics ,Extended finite element method - Abstract
A hybrid finite element model based on F-Trefftz kernels (fundamental solutions) is formulated for analyzing Dirichlet problems associated with two-dimensional nonlinear Poisson-type equations including nonlinear Poisson–Boltzmann equation and diffusion–reaction equation. The nonlinear force term in the Poisson-type equation is frozen by introducing the imaginary terms at each Picard iteration step, and then the induced Poisson problem is solved by the present hybrid finite element model involving element boundary integrals only, coupling with the particular solution method with radial basis function interpolation. The numerical accuracy of the present method is investigated by numerical experiments for problems with complex geometry and various nonlinear force functions.
- Published
- 2012
228. Depletion of CD4+ T cells abrogates post-peak decline of viremia in SIV-infected rhesus macaques
- Author
-
Elena V. Ryzhova, Yanjie Yi, James G. Else, Lawrence R. Sternberg, Ronald G. Collman, Alexandra M. Ortiz, Bing Li, Paul M. Carnathan, Brian Tabb, Sarah J. Ratcliffe, Jessica C. Engram, Xing Pei Hao, Francisco Gonzalez-Scarano, Elizabeth M. Cramer, Nichole R. Klatt, Benton Lawson, Jason M. Brenchley, Dawn M. Little, Mirko Paiardini, Aftab A Ansari, Jacob D. Estes, Cynthia A. Derdeyn, and Guido Silvestri
- Subjects
CD4-Positive T-Lymphocytes ,viruses ,T cell ,Simian Acquired Immunodeficiency Syndrome ,Viremia ,Biology ,Virus Replication ,medicine.disease_cause ,Lymphocyte Depletion ,Immune system ,In vivo ,medicine ,Animals ,Antilymphocyte Serum ,DNA Primers ,Base Sequence ,virus diseases ,General Medicine ,Viral Load ,Simian immunodeficiency virus ,medicine.disease ,Macaca mulatta ,Virology ,medicine.anatomical_structure ,Viral replication ,CD4 Antigens ,Immunology ,RNA, Viral ,Simian Immunodeficiency Virus ,Viral load ,CD8 ,Research Article - Abstract
CD4+ T cells play a central role in the immunopathogenesis of HIV/AIDS, and their depletion during chronic HIV infection is a hallmark of disease progression. However, the relative contribution of CD4+ T cells as mediators of antiviral immune responses and targets for virus replication is still unclear. Here, we have generated data in SIV-infected rhesus macaques (RMs) that suggest that CD4+ T cells are essential in establishing control of virus replication during acute infection. To directly assess the role of CD4+ T cells during primary SIV infection, we in vivo depleted these cells from RMs prior to infecting the primates with a pathogenic strain of SIV. Compared with undepleted animals, CD4+ lymphocyte-depleted RMs showed a similar peak of viremia, but did not manifest any post-peak decline of virus replication despite CD8+ T cell- and B cell-mediated SIV-specific immune responses comparable to those observed in control animals. Interestingly, depleted animals displayed rapid disease progression, which was associated with increased virus replication in non-T cells as well as the emergence of CD4-independent SIV-envelopes. Our results suggest that the antiviral CD4+ T cell response may play an important role in limiting SIV replication, which has implications for the design of HIV vaccines.
- Published
- 2011
229. Real-Time Object Tracking Based on Android Platform
- Author
-
Cai Lian Chen, Xing Pei Zhai, Guan Nan Su, and Jing Hui Chu
- Subjects
Java ,business.industry ,Computer science ,Java Native Interface ,Real-time computing ,General Engineering ,Object detection ,Android Beam ,Embedded system ,Video tracking ,Android (operating system) ,business ,computer ,computer.programming_language - Abstract
A real-time application is proposed for Android smart phone. To achieve the best tradeoff between the complexity and the processing efficiency, Java Native Interface (JNI) is used rather than pure Java. The performance of the application is tested on an Android smart phone by dealing with various pedestrian videos. And the experimental results show that the application successfully detects and tracks certain moving object.
- Published
- 2011
230. Welding Defect Analysis in Thin-Walled Steel Tube under Bending Moment
- Author
-
Hong Sheng Cai, Xing Pei Liang, Zhao Hua Wang, Jin Feng Geng, Hui Wang, and Yu Jie Wang
- Subjects
Strain energy release rate ,Materials science ,business.industry ,General Medicine ,Structural engineering ,Welding ,Bending ,law.invention ,law ,Pure bending ,Welding defect ,Bending moment ,Arc welding ,Composite material ,business ,Stress intensity factor - Abstract
The linear elastic problem for two welded thin-walled steel tubes containing circular arc weld defect subjected to bending load is analyzed in the present paper. The welding defect is firstly simplified as a circular arc crack and then the finite element based technique is used to calculate the corresponding energy release rate (J-integral), which is related to stress intensity factor directly. Finally, the arc length of welding defect is changed to investigate the variation of stress intensity factors.
- Published
- 2011
231. Three-Dimensional Finite Element Analysis of Steel Silo
- Author
-
Chang Bing Chen, Shou Yi Bi, and Xing Pei Liang
- Subjects
Wall stress ,Engineering ,Basis (linear algebra) ,business.industry ,Silo ,Construction design ,General Medicine ,Structural engineering ,business ,Size effect on structural strength ,Intensity (heat transfer) ,Finite element method - Abstract
In this paper strength and wall stress of a steel silo were calculated in designing by using 3-D finite element method. According to the analysis result, intensity inspection and structure optimization were executed, which could provide the reference basis for construction design.
- Published
- 2011
232. Simulation for Silos Discharge with 2D DEM
- Author
-
Shou Yi Bi and Xing Pei Liang
- Subjects
Engineering ,Mechanical equilibrium ,Information silo ,business.industry ,General Engineering ,Wall pressure ,Static pressure ,Structural engineering ,Discrete element method ,law.invention ,Pressure measurement ,law ,Silo ,Dynamic pressure ,business - Abstract
In this paper, using the discrete element method (PFC2D)particle flow procedure to establish a model of cylindrical silo, in the warehouse filled with particles within the reach of static equilibrium state, then the record of its wall static lateral pressure measurement value, while monitoring the measured dynamic wall pressure during the silo discharging. It was shown that the static pressure as well as the dynamic pressure simulated with the numerical model is in good agreement with the experimental results. So the discrete element method can give a new way to study dynamic question of silos.
- Published
- 2011
233. Anti-Calculated Method of Static Pressure for Silo
- Author
-
Hui Wang and Xing Pei Liang
- Subjects
Engineering ,Strain (chemistry) ,business.industry ,General Engineering ,Structural engineering ,Static pressure ,Finite element method ,Hoop strain ,symbols.namesake ,Silo ,Taylor series ,symbols ,Sensitivity (control systems) ,business - Abstract
In this paper, the anti-calculated method for the static pressure associated with the silo structure is developed and the strain sensitivity is derived based on the formulations of the finite element method. In the proposed approach, the Taylor expansion technique at the initial guess strain is used to evaluate the hoop strain at adjacent points and the least square method are employed to match the numerical results and the known test results. Finally, the developed algorithm is verified by solving the silo with internal wall.
- Published
- 2011
234. Numerical Modeling of Welding Temperature in Centrifuge Concrete-Filled Steel Tubular Columns
- Author
-
Hong Sheng Cai, Jin Feng Geng, Hui Wang, and Xing Pei Liang
- Subjects
Centrifuge ,Materials science ,business.industry ,General Engineering ,Stiffness ,Welding ,Structural engineering ,Finite element method ,law.invention ,Thermal conductivity ,Properties of concrete ,law ,Thermal ,medicine ,Composite material ,medicine.symptom ,business ,Thermal analysis - Abstract
The objective of this study is to develop a finite element analysis model that simulates the temperature profile in concrete-filled steel tubular structures during welding procedure in which several metal plates are fixed on the outer surface of steel tube to increase the strength and stiffness of it. In the present model, the thermal property such as thermal conductivity of the steel phase is assumed to be functions of temperature variable. Spatial and temporal distributions of temperature are illustrated under extreme weld heating conditions to investigate the behaviors of the structure at every time step. Simulation results indicate that the maximum value of temperature on the interface of steel and concrete caused by the weld heat source doesn’t damage the mechanical properties of concrete and steel.
- Published
- 2011
235. A Numerical Integration Method of Dynamic Finite Element Analysis
- Author
-
Xing Pei Liang
- Subjects
Mathematical optimization ,Acceleration ,General Engineering ,Applied mathematics ,Smoothed finite element method ,Newmark-beta method ,Mixed finite element method ,Boundary knot method ,Discrete element method ,Finite element method ,Mathematics ,Extended finite element method - Abstract
A new numerical integration method for dynamic finite element analysis is proposed in the paper. In the proposed algorithm, the acceleration change in a particular time step is first assumed to be curved variation, and then the displacement vector, velocity vector and acceleration vector at the current instance can be expressed in terms of the results at last time instance. Because of the curvilinear property of the acceleration change in a particular time interval, the complicated dynamical responding such as high-oscillatory modes can be captured with the present method. The efficiency and accuracy of the proposed algorithm are validated by two numerical examples and numerical results show that the present formulation has better accuracy than the Wilson’s method and the Newmark’s method used in the conventional finite element method.
- Published
- 2011
236. Syntheses, characterizations and biological activities of two Cu(II) complexes with acylhydrazone ligand bearing pyrrole unit
- Author
-
Zhao-Po Zhang, Xing-Pei Ye, Jun Xu, Yuan Wang, Wei-Na Wu, Taofeng Zhu, Tieliang Ma, and Lei Jia
- Subjects
Stereochemistry ,Ligand ,Imine ,chemistry.chemical_element ,Crystal structure ,Copper ,Square pyramidal molecular geometry ,Inorganic Chemistry ,chemistry.chemical_compound ,Deprotonation ,chemistry ,Materials Chemistry ,Physical and Theoretical Chemistry ,Coordination geometry ,Pyrrole - Abstract
Two novel Cu(II) complexes, [Cu(L)2(CH3OH)]·CH3OH (1) and [Cu(L)(DMF)Cl] (2) based on HL (where HL = 2-ethoxycarbonyl-5-formyl-3,4-dimethylpyrrole 4-hydroxylbenzoylhydrazone) were synthesized and characterized by X-ray diffraction analyses. The results show that in each complex, the acylhydrazone ligand is deprotonated and coordinated to the copper(II) ion via enolizated oxygen and imine nitrogen atoms. The central metal ion possesses a distorted square pyramidal and a square-planar coordination geometry in complexes 1 and 2, respectively. In addition, complex 2 shows obvious inhibitory effect to bacterial strains Staphylococcus aureus and Salmonella typhimurium, and complex 1 has excellent antitumor activity towards Hepatocellular carcinoma (Hep G2) cells (IC50 = 2.0 μM).
- Published
- 2014
237. Steady State Dynamic Performance of the Slab with EPS-Blocks
- Author
-
Lu Min Wang, Da Ying Zhang, and Xing Pei Liang
- Subjects
Materials science ,Steady state (electronics) ,business.industry ,Modal analysis ,General Engineering ,Stiffness ,Structural engineering ,Stress (mechanics) ,Harmonic analysis ,Compressive strength ,Slab ,medicine ,medicine.symptom ,business ,Body orifice - Abstract
In this paper, novel filled materials EPS-blocks of cast-in-situ slabs are presented. And EPS-blocks with light weight which are inexpensive are validated to be sufficient strong as filled materials to bring an innovation for the development of cast-in-situ slabs. Based on modal analysis, it is found that the decreased weight has a greater influence to the mode of the slab than the weakened stiffness. According to harmonic response analysis, tensile stress distributions of the slab with EPS-blocks are depicted in figures and explained. Typically, orifice stress distributions are expounded and stress variations of nodes in different places are illustrated. From these studies, it is concluded that the steady state dynamic performance of the slab with EPS-blocks is good.
- Published
- 2010
238. Design and Construction of the Slab with Novel Filled Material
- Author
-
Da Ying Zhang, Xing Pei Liang, and Lu Min Wang
- Subjects
Cement ,Materials science ,Construction method ,General Engineering ,Slab ,Torus ,Composite material ,Expanded polystyrene - Abstract
A new cast-in-situ slab which is filled with novel filled material (EPS-block) consisting of disused expanded polystyrene plastic granule, cement and building cementing powder is invented. EPS-block with perfect centrosymmetric torus shape is very suitable for filling into two-way slabs. It breaks a new path to use disused expanded polystyrene foam, and reduces environment pollution greatly. Through the practical study of the slab with EPS-block, the appropriate construction method is found out, and the dependable construction technique is afforded for further development of the slab with EPS-block.
- Published
- 2010
239. The Historical Revelations from the Chinese Civilization
- Author
-
Yuan Xing-pei
- Subjects
Literature ,History ,Civilization ,business.industry ,media_common.quotation_subject ,General Materials Science ,business ,media_common - Published
- 2010
240. Performance analysis and test for passive RFID system at UHF band
- Author
-
Honggang Wang, Chang-xing Pei, and Feng Zheng
- Subjects
Computer Networks and Communications ,Computer science ,HFSS ,business.industry ,Delay spread ,Root mean square ,Ultra high frequency ,Signal Processing ,Computer Science::Networking and Internet Architecture ,Electronic engineering ,Radio-frequency identification ,Fading ,Telecommunications ,business ,Circular polarization ,Multipath propagation ,Information Systems - Abstract
Performance analysis and test for passive radio frequency identification (RFID) system at ultra high frequency (UHF) band in free space and line-of-sight (LOS) indoor environments are conducted in this article. Performance degradation of different materials is presented, in terms of power received by tag and reader, communication range and link information rates, etc. Particularly, the multipath fading and root mean square (RMS) delay spread in LOS indoor environments are analyzed by a 5-ray model with different polarization, such as horizontal polarization, vertical polarization and circular polarization. A practical test is carried out on an indoor balcony of an office building. In addition, the electric field environment is simulated to analyze multipath degradation using the tool of Ansoft HFSS. According to the test, the recognition rate is almost consistent with the results of theoretical analysis and simulation. The small scale fading and the field nulls are observed. The multipath degradation significantly affects the passive RFID system on communication range and recognition rate, and it is also one of the key limitations on system performance. The variations of power in multipath environments can also influence the information rates, while the rates are still enough for available standard and applications at short range.
- Published
- 2009
241. Energy Efficient Physical Layer Design for Passive RFID System
- Author
-
Yun-Hui Yi, Chang-Xing Pei, and Hong-Gang Wang
- Subjects
Computer Networks and Communications ,Hardware and Architecture ,Computer science ,Electronic engineering ,Physical layer ,Computer Graphics and Computer-Aided Design ,Software ,Efficient energy use - Published
- 2009
242. Taq Qian and classical Chinese paintings
- Author
-
Yuan Xing-pei
- Subjects
Literature ,Painting ,Literature and Literary Theory ,business.industry ,media_common.quotation_subject ,History of China ,Art ,language.human_language ,Asian studies ,Portrait ,Classical Chinese ,language ,Icon ,China ,business ,computer ,media_common ,computer.programming_language - Abstract
Tao Qian–related paintings created in ancient China can be divided into three categories: paintings inspired by Tao Qian’s literary pieces; paintings inspired by his anecdotes; portraits for Tao Qian. These paintings have made Tao Qian a cultural icon representative of aesthetics of placid rural seclusion. This article aims to reveal the aesthetic implications of Tao Qian as a cultural icon by finding information about lost paintings taking inspiration from him or assessing the authenticity of relevant ancient paintings preserved in museums or collected by collectors.
- Published
- 2009
243. Comparative study of PILF and TLIF treatment in adult degenerative spondylolisthesis
- Author
-
Denglu Yan, Fu-xing Pei, Jian Li, and Chenglong Soo
- Subjects
Male ,medicine.medical_specialty ,Schmidt sting pain index ,medicine.medical_treatment ,Bone Screws ,Lumbar vertebrae ,Postoperative Complications ,Lumbar ,Foramen ,Humans ,Medicine ,Internal fixation ,Orthopedics and Sports Medicine ,Lumbar Vertebrae ,business.industry ,Middle Aged ,medicine.disease ,Low back pain ,Internal Fixators ,Spondylolisthesis ,Surgery ,Spinal Fusion ,medicine.anatomical_structure ,Spinal fusion ,Female ,Original Article ,medicine.symptom ,business ,Low Back Pain - Abstract
This study is to compare the therapeutic effect of posterior lumbar interbody fusion (PLIF) and transforaminal lumbar interbody fusion (TLIF) with pedicle screw fixation on treatment in adult degenerative spondylolisthesis. A retrospective analysis of 187 patients to compare the complications and associated predictive factors of the two techniques of one level lumbar fusion. Ninety-one had PLIF with two cages and pedicle fixation (group 1), and ninety-six had TLIF with one cage and pedicle fixation (group 2). The two groups had similar age and sex distribution, and level of pain. Inclusion criteria and outcome measurements were identical in both groups. The two groups were operated on with autograft and cage with pedicle fixation. Before surgery and at the 2-year follow-up, pain (VAS) and functional disability (JOA) were quantified. The results showed there were no intraoperative deaths in our study. In the end 176 cases had 2-year follow-up while 11 cases were lost to follow-up. The follow-up rate was 93.4% (85/91) in the PLIF group and 94.8% (91/96) in the TLIF group. All patients had bone fusion, and there were no cases of cage extrusion. The pain index improved from 7.08 +/- 1.13 to 2.84 +/- 0.89 in PLIF patients and improved from 7.18 +/- 1.09 to 2.84 +/- 0.91 in TLIF patients (P0.001). There were 42 cases of excellent, 29 cases of good, 11 cases of general, and 3 cases of poor results in PLIF group. There were 46 cases of excellent, 31 case of good, 12 case of general, and 2 cases of poor results in TLIF group. The JOA score in all patients was 84.1% of good or excellent (83.5% in PLIF and 84.6% in TLIF, P0.05). The average preoperative slip was 30.1 +/- 7.2% in PLIF group while in the TLIF it was 31.4 +/- 8.3%. Immediately post operatively it was reduced to 7.3 +/- 2.1% and 7.4 +/- 2.7% and at last F/U it was 8.1 +/- 2.8% and 8.2 +/- 2.6%, respectively. The average of reduction rate was 75.2 +/- 6.4% in PLIF and 75.4 +/- 6.2 in TLIF on the initial post operatively X-ray, and 72.6 +/- 5.2% and 72.4 +/- 5.4% on the follow-up. The percentage rate, reduction rate and lost of reduction rate between the two groups was similar (P0.05). The average pre operative disk and foramen height in the PLIF group improved from 6.8 +/- 2.3 and 14.2 +/- 1.7 preoperatively to 11.6 +/- 1.5 and 18.7 +/- 1.8 post operatively, respectively. At last follow up there was minimal lost of correction down to 11.24 +/- 1.2 and 18.1 +/- 1.8, respectively. Similarly in the TLIF group, pre operative disk and foramen height were improved from 6.7 +/- 1.7 and 14.1 +/- 1.8 to 11.4 +/- 1.6 and 18.5 +/- 1.6 immediately post operative. At last follow up minimal lost of correction was noted with average disc height of 11.3 +/- 1.4 and 18.2 +/- 1.7. Both techniques achieve statistical significance in restoration of disc and foraminal (P0.01); however, there was no statistical difference between the two techniques. In conclusion, interbody fusion with either a PLIF technique or a TLIF technique provides good outcomes in the treatment of adult degenerative spondylolisthesis. The TLIF procedure is simpler and is as safe and effective as the PLIF technique.
- Published
- 2008
244. Multiscale combination of climate model simulations and proxy records over the last millennium
- Author
-
Chen, Xin, primary, Xing, Pei, additional, Luo, Yong, additional, Nie, Suping, additional, Zhao, Zongci, additional, Huang, Jianbin, additional, and Tian, Qinhua, additional
- Published
- 2017
- Full Text
- View/download PDF
245. A facile in situ synthesis of MIL-101-CdSe nanocomposites for ultrasensitive electrochemiluminescence detection of carcinoembryonic antigen
- Author
-
Liu, Qiao, primary, Yang, Ying, additional, Liu, Xing-Pei, additional, Wei, Yu-Ping, additional, Mao, Chang-Jie, additional, Chen, Jing-Shuai, additional, Niu, He-Lin, additional, Song, Ji-Ming, additional, Zhang, Sheng-Yi, additional, Jin, Bao-Kang, additional, and Jiang, Meng, additional
- Published
- 2017
- Full Text
- View/download PDF
246. A novel Ag 3 PO 4 /CuO nanocomposite with enhanced photocatalytic performance
- Author
-
Chen, Jingshuai, primary, Liu, Xing-Pei, additional, Yang, Xiao-Dong, additional, Jiang, Liang-Liang, additional, Mao, Chang-Jie, additional, Niu, Helin, additional, Jin, Bao-Kang, additional, and Zhang, Shengyi, additional
- Published
- 2017
- Full Text
- View/download PDF
247. Experimental colitis in SIV-uninfected rhesus macaques recapitulates important features of pathogenic SIV infection
- Author
-
Jan Kristoff, Peter L. Choyke, Luis D. Giavedoni, Charles M. Trubey, Marcelino Bernardo, Nichole R. Klatt, Srinivas S. Rao, Jacob D. Estes, Jason M. Brenchley, Claire Deleage, Amy Xu, Cristian Apetrei, Brandon F. Keele, Gregory Q. Del Prete, David R. Morcock, Carissa Lucero, Baris Turkbey, Jeffrey D. Lifson, W. Gregory Alvord, Xing Pei Hao, Ivona Pandrea, and Jeremy Smedley
- Subjects
Male ,animal diseases ,Simian Acquired Immunodeficiency Syndrome ,General Physics and Astronomy ,Inflammation ,Biology ,medicine.disease_cause ,Article ,General Biochemistry, Genetics and Molecular Biology ,Pathogenesis ,medicine ,Animals ,Colitis ,Gastrointestinal tract ,Multidisciplinary ,Dextran Sulfate ,Experimental colitis ,RNA ,General Chemistry ,Simian immunodeficiency virus ,medicine.disease ,Macaca mulatta ,Chemically-induced colitis ,3. Good health ,Gastrointestinal Tract ,Immunology ,Female ,Simian Immunodeficiency Virus ,medicine.symptom - Abstract
Mucosal damage to the gastrointestinal (GI) tract with resulting microbial translocation is hypothesized to significantly contribute to the heightened and persistent chronic inflammation and immune activation characteristic to HIV infection. Here we employ a non-human primate model of chemically induced colitis in SIV-uninfected rhesus macaques that we developed using dextran sulfate sodium (DSS), to directly test this hypothesis. DSS treatment results in GI barrier damage with associated microbial translocation, inflammation and immune activation. The progression and severity of colitis are longitudinally monitored by a magnetic resonance imaging approach. DSS treatment of SIV-infected African green monkeys, a natural host species for SIV that does not manifest GI tract damage or chronic immune activation during infection, results in colitis with elevated levels of plasma SIV RNA, sCD14, LPS, CRP and mucosal CD4+ T-cell loss. Together these results support the hypothesis that GI tract damage leading to local and systemic microbial translocation, and associated immune activation, are important determinants of AIDS pathogenesis., HIV-1 infection in humans and SIV infection in rhesus macaques are associated with mucosal damage to the gastrointestinal tract, microbial translocation and chronic immune activation. Here the authors develop a non-human primate DSS colitis model that recapitulates these aspects of the disease in uninfected rhesus macaques.
- Published
- 2015
248. Study on irregular spherical latticed roof of silo
- Author
-
Wang, Xian-Cheng, primary, Zhang, Meng-Yang, additional, Yuan, Fang, additional, Su, Peng, additional, and Liang, Xing-Pei, additional
- Published
- 2016
- Full Text
- View/download PDF
249. [Acetabular morphological analysis in patients with high dislocated DDH using three-dimensional surface reconstruction technique]
- Author
-
Yi, Zengy, Li, Min, Ou-jie, Lai, Bin, Shen, Jing, Yang, Zong-ke, Zhou, Peng-de, Kang, and Fu-xing, Pei
- Subjects
Imaging, Three-Dimensional ,Humans ,Acetabulum ,Orthopedic Procedures ,Tomography, X-Ray Computed ,Hip Dislocation, Congenital ,Software - Abstract
To simulate acetabular morphology and perform acetabular quantitative analysis in high dislocated developmental dysplasia of the hip (DDH) patients using three-dimensional (3D) surface reconstruction technique, in order to understand the acetabular anatomic features and develop operative strategies for acetabular reconstruction.3D pelvic images were reconstructed by Mimics software from CT data of 13 patients (13 hips) with high developmental DDH and 13 normal persons (26 hips). True acetabular superior-inferior diameter, anterior-posterior diameter, acetabular depth, medial wall thickness, abduction angle and anteversion angle were measured and compared between the two groups of participants.Irregular acetabular shape was found in high dislocated group, showing a triangle with wide upper and narrow lower. The acetabular quantitative analysis revealed (38.29 +/- 2.71) mm superior-inferior diameter, (21.74 +/- 5.33) mm anterior-posterior diameter, (15.50 +/- 2.93) mm acetabular depth, (6.80 +/- 2.97) mm medial wall thickness, (49.29 +/- 7.40) degrees abduction angle and (23.82 +/- 11.21) degrees anteversion angle in high dislocated patients. The superior-inferior diameter, anterior-posterior diameter and acetabular depth of high dislocated patients were significantly smaller than those of the normal contirols (P0.05). However, the medial wall thickness, abduction angle and anteversion angle of high dislocated patients were significantly bigger than those of the normal controls (P0.05).3D reconstruction technique can restore true acetabular morphology and perform quantitative analysis. Compared with normal controls, high dislocated DDH patients have acetabular features: irregular shape, lower opening, higher medial wall and bigger abduction and anteversion angles. Joint arthroplasty surgery in high dislocated DDH patients needs to look at these acetabular features.
- Published
- 2015
250. Performance analysis of two-way AF cooperative networks with relay selection over Nakagami-m fading channels
- Author
-
Chang-Xing Pei, Chen-Hong Yao, and Jing Guo
- Subjects
Relay ,law ,Computer science ,Fading ,Nakagami distribution ,Topology ,Selection (genetic algorithm) ,law.invention - Published
- 2015
Catalog
Discovery Service for Jio Institute Digital Library
For full access to our library's resources, please sign in.