873 results on '"Raffaele Ferri"'
Search Results
2. Combined Effect of Red Wine and Mocha Pot Coffee in Mild Vascular Cognitive Impairment
- Author
-
Manuela Pennisi, Mariagiovanna Cantone, Francesco Cappellani, Carmen Concerto, Raffaele Ferri, Justyna Godos, Giuseppe Grosso, Giuseppe Lanza, Alessandro Rodolico, Giulia Torrisi, Wahidah H. Al-Qahtani, Francesco Fisicaro, and Rita Bella
- Subjects
diet ,cognitive impairment ,depression ,cerebral small vessel disease ,prevention ,Medicine ,Biology (General) ,QH301-705.5 - Abstract
Objectives: Moderate daily mocha pot coffee intake has been associated with better mood and cognition in patients with mild vascular cognitive impairment (VCI). Similarly, moderate red wine consumption has shown protective effects on cognitive disorders, including Alzheimer's disease and vascular dementia. The aim of this study was to explore the synergistic relation between red wine and coffee intake on mood and cognitive status in mild VCI patients at risk for dementia. Methods: A total of 300 non-demented older patients with mild VCI were asked for coffee and red wine consumption and administered with the 17-items Hamilton Depression Rating Scale (HDRS), the Mini Mental State Examination (MMSE), and the Stroop Color-Word Interference Test (Stroop T), as well as the Activities of Daily Living (ADL) and the Instrumental ADL to measure their mood status, cognitive performance, and functional independence. Linear regression models were used to test the association between variables. Results: Moderate wine drinkers tended to show the best Stroop T score at any level of coffee consumption; conversely, heavy wine consumers performed worse at the Stroop T, especially in patients reporting high coffee intake. Moderate drinkers of both coffee and wine showed the lowest HDRS scores. Finally, a progressive increase in MMSE score was evident with increasing coffee consumption, which peaks when combined with a moderate wine consumption. Conclusions: Daily mocha pot coffee and red wine intake seem to be synergistically associated with global cognition, executive functioning, and mood status in patients with mild VCI; the association was not linear, resulting in a protective direction for moderate intake and detrimental for heavy consumption. Future studies are needed to further corroborate the present findings and the potential long-term protective effects of these dietary compounds over time.
- Published
- 2024
- Full Text
- View/download PDF
3. Case report: Applied behavior analysis in a case of anomic aphasia in post-acute myocardial infarction with cardiac arrest and brain hypoxia: results of tact-training
- Author
-
Valentina Catania, Guido D’Angelo, Simonetta Panerai, Bartolo Lanuzza, and Raffaele Ferri
- Subjects
aphasia ,anomic aphasia ,stroke ,ABA ,applied verbal behavior ,verbal operants ,Psychology ,BF1-990 - Abstract
PurposeApplied Behavior Analysis (ABA) tact-training was provided to an adult with post-stroke anomic aphasia, with the main purposes to improve naming of pictures, with a possible generalization to another different setting, through telehealth sessions.MethodThe Multiple probe experimental design across behaviors was used. Two sets of stimuli were used (SET 1 and SET 2), including 60 laminated photos, belonging to three different categories for each set. Procedure included the baseline, the intervention phases (face-to-face and telehealth sessions), and the follow-up (1 month after the end of a tact training).ResultsFor both, SET 1 and SET 2, the mastery criterion (80% correct stimulus tacts, for three consecutive times, simultaneously for all categories) was achieved. No increased percentage of correct picture tacts was found for untrained items. At follow-up, the patient provided 70 to 100% correct responses. For both SET 1 and SET 2, telehealth did not modify the correct response trends.ConclusionThe results of our study seem to suggest that specific tact-training procedures might be successfully carried out in adult and elderly people with post-stroke aphasia. It also appears necessary to arrange protocols providing telehealth sessions, with benefits for both families and the health system.
- Published
- 2024
- Full Text
- View/download PDF
4. Unveiling the pathophysiology of restless legs syndrome through transcriptome analysis
- Author
-
Maria P. Mogavero, Michele Salemi, Giuseppe Lanza, Antonio Rinaldi, Giovanna Marchese, Maria Ravo, Maria Grazia Salluzzo, Amedeo Antoci, Lourdes M. DelRosso, Oliviero Bruni, Luigi Ferini-Strambi, and Raffaele Ferri
- Subjects
Neurology ,Bioinformatics ,Transcriptomics ,Science - Abstract
Summary: The aim of this study was to analyze signaling pathways associated with differentially expressed messenger RNAs in people with restless legs syndrome (RLS). Seventeen RLS patients and 18 controls were enrolled. Coding RNA expression profiling of 12,857 gene transcripts by next-generation sequencing was performed. Enrichment analysis by pathfindR tool was carried-out, with p-adjusted ≤0.001 and fold-change ≥2.5. Nine main different network groups were significantly dysregulated in RLS: infections, inflammation, immunology, neurodegeneration, cancer, neurotransmission and biological, blood and metabolic mechanisms. Genetic predisposition plays a key role in RLS and evidence indicates its inflammatory nature; the high involvement of mainly neurotropic viruses and the TORCH complex might trigger inflammatory/immune reactions in genetically predisposed subjects and activate a series of biological pathways—especially IL-17, receptor potential channels, nuclear factor kappa-light-chain-enhancer of activated B cells, NOD-like receptor, mitogen-activated protein kinase, p53, mitophagy, and ferroptosis—involved in neurotransmitter mechanisms, synaptic plasticity, axon guidance, neurodegeneration, carcinogenesis, and metabolism.
- Published
- 2024
- Full Text
- View/download PDF
5. Low TGF-β1 plasma levels are associated with cognitive decline in Down syndrome
- Author
-
Margherita Grasso, Annamaria Fidilio, Francesca L’Episcopo, Marilena Recupero, Concetta Barone, Maria Giulia Bacalini, Cristina Benatti, Maria Concetta Giambirtone, Giuseppe Caruso, Donatella Greco, Santo Di Nuovo, Corrado Romano, Raffaele Ferri, Serafino Buono, A. Claudio Cuello, Johanna M. C. Blom, Fabio Tascedda, Pier Vincenzo Piazza, Rafael De La Torre, and Filippo Caraci
- Subjects
Down’s syndrome ,cognitive decline ,TGF-β1 ,PBMCs ,blood-based biomarker ,Therapeutics. Pharmacology ,RM1-950 - Abstract
Almost all individuals with Down’s syndrome (DS) show the characteristic neuropathological features of Alzheimer’s disease (AD) by the age of 40, yet not every individual with DS experiences symptoms of AD later in life. Similar to neurotypical developing subjects, AD in people with DS lasts for a long preclinical phase in which biomarkers follow a predictable order of changes. Hence, a prolonged asymptomatic period precedes the onset of dementia, underscoring the importance of identifying new biomarkers for the early detection and monitoring of cognitive decline in individuals with DS. Blood-based biomarkers may offer an alternative non-invasive strategy for the detection of peripheral biological alterations paralleling nervous system pathology in an early phase of the AD continuum. In the last few years, a strong neurobiological link has been demonstrated between the deficit of transforming growth factor-β1 (TGF-β1) levels, an anti-inflammatory cytokine endowed with neuroprotective activity, and early pro-inflammatory processes in the AD brain. In this clinical prospective observational study, we found significant lower plasma TGF-β1 concentrations at the first neuropsychological evaluation (baseline = T0) both in young adult DS individuals (19–35 years) and older DS subjects without AD (35–60 years) compared to age- and sex-matched healthy controls. Interestingly, we found that the lower TGF-β1 plasma concentrations at T0 were strongly correlated with the following cognitive decline at 12 months. In addition, in young individuals with DS, we found, for the first time, a negative correlation between low TGF-β1 concentrations and high TNF-α plasma concentrations, a pro-inflammatory cytokine that is known to be associated with cognitive impairment in DS individuals with AD. Finally, adopting an ex vivo approach, we found that TGF-β1 concentrations were reduced in parallel both in the plasma and in the peripheral blood mononuclear cells (PBMCs) of DS subjects, and interestingly, therapeutic concentrations of fluoxetine (FLX) applied to cultured PBMCs (1 µM for 24 h) were able to rescue TGF-β1 concentrations in the culture media from DS PBMCs, suggesting that FLX, a selective serotonin reuptake inhibitor (SSRI) endowed with neuroprotective activity, might rescue TGF-β1 concentrations in DS subjects at higher risk to develop cognitive decline.
- Published
- 2024
- Full Text
- View/download PDF
6. The Triad of Sleep, Immunity, and Cancer: A Mediating Perspective
- Author
-
Giuseppe Lanza, Maria P. Mogavero, Michele Salemi, and Raffaele Ferri
- Subjects
sleep ,immunity ,cancer ,immune regulation ,tumor microenvironment ,sleep interventions ,Cytology ,QH573-671 - Abstract
The triadic interplay between sleep, immunity, and cancer represents a growing area of biomedical research with significant clinical implications. This review synthesizes the current knowledge on how sleep influences immune function, the immune system’s role in cancer dynamics, and the direct connections between sleep patterns and cancer risk. After a comprehensive overview of the interrelationships among these three domains, the mechanisms of sleep in immune function are described, detailing how sleep regulates the immune system, the effects of sleep duration and quality on immune responses, and the underlying molecular and cellular mechanisms. Also, the complex relationship between immunity and cancer is explored, highlighting the immune system’s role in cancer prevention and progression, immune surveillance, tumor microenvironment, and the implications of immunodeficiency and immune modulation on cancer risk. The direct connections between sleep and cancer are then described, presenting epidemiological evidence linking sleep patterns to cancer risk, biological mechanisms that influence cancer development, and the role of sleep disorders in cancer prognosis. The mediating role of sleep between immunity and cancer is highlighted, proposing hypothesized pathways, summarizing evidence from experimental and clinical studies, and evaluating the impact of sleep interventions on immune function and cancer outcomes. This review concludes by discussing the clinical implications and future directions, emphasizing the potential for sleep-based interventions in cancer prevention and treatment, the integration of sleep management in oncology and immunotherapy, and outlining a future research agenda. This agenda includes understanding the mechanisms of the sleep–immunity–cancer interplay, conducting epidemiological studies on sleep and cancer risk, assessing the impact of sleep management in cancer treatment protocols, exploring sleep and tumor microenvironment interactions, and considering policy and public health implications. Through a detailed examination of these interconnected pathways, this review underscores the critical importance of sleep in modulating immune function and cancer outcomes, advocating for interdisciplinary research and clinical strategies to harness this knowledge for improved health outcomes.
- Published
- 2024
- Full Text
- View/download PDF
7. Transcriptome Study in Sicilian Patients with Autism Spectrum Disorder
- Author
-
Michele Salemi, Francesca A. Schillaci, Giuseppe Lanza, Giovanna Marchese, Maria Grazia Salluzzo, Angela Cordella, Salvatore Caniglia, Maria Grazia Bruccheri, Anna Truda, Donatella Greco, Raffaele Ferri, and Corrado Romano
- Subjects
mRNAs ,RNA sequencing ,autism spectrum disorder ,transcriptome analysis ,Biology (General) ,QH301-705.5 - Abstract
ASD is a complex condition primarily rooted in genetics, although influenced by environmental, prenatal, and perinatal risk factors, ultimately leading to genetic and epigenetic alterations. These mechanisms may manifest as inflammatory, oxidative stress, hypoxic, or ischemic damage. To elucidate potential variances in gene expression in ASD, a transcriptome analysis of peripheral blood mononuclear cells was conducted via RNA-seq on 12 ASD patients and 13 healthy controls, all of Sicilian ancestry to minimize environmental confounds. A total of 733 different statistically significant genes were identified between the two cohorts. Gene Set Enrichment Analysis (GSEA) and Gene Ontology (GO) terms were employed to explore the pathways influenced by differentially expressed mRNAs. GSEA revealed GO pathways strongly associated with ASD, namely the GO Biological Process term “Response to Oxygen-Containing Compound”. Additionally, the GO Cellular Component pathway “Mitochondrion” stood out among other pathways, with differentially expressed genes predominantly affiliated with this specific pathway, implicating the involvement of different mitochondrial functions in ASD. Among the differentially expressed genes, FPR2 was particularly highlighted, belonging to three GO pathways. FPR2 can modulate pro-inflammatory responses, with its intracellular cascades triggering the activation of several kinases, thus suggesting its potential utility as a biomarker of pro-inflammatory processes in ASD.
- Published
- 2024
- Full Text
- View/download PDF
8. Polysomnographically Defined Restless Sleep Disorder and Periodic Limb Movements during Sleep in Children Born Prematurely
- Author
-
Lourdes M. DelRosso, Hovig Artinian, Maria P. Mogavero, Oliviero Bruni, Manisha Witmans, Mary Anne Tablizo, Michelle Sobremonte-King, and Raffaele Ferri
- Subjects
restless sleep disorder ,periodic limb movement during sleep ,prematurity ,Pediatrics ,RJ1-570 - Abstract
Introduction: Children born prematurely (5, children with RSD, and children with neither elevated PLMS index nor RSD. Results: During the study, 2577 sleep studies were reviewed. Ninety-two studies fit our criteria and were included in the analysis. The median age at birth was 31 weeks, and the interquartile range (IQR) was 27–34 weeks. A total of 32 (34.8%) children were referred for restless sleep and 55 (59.8%) for snoring. After polysomnography, 18% were found to have a PLMS index >5/h, and 14% fit the criteria for restless sleep disorder (RSD). There were no statistically significant differences in PSG parameters among the children with RSD, PLMS, and the remaining group, except for lower obstructive apnea/hypopnea index (Kruskal–Wallis ANOVA 8.621, p = 0.0135) in the RSD group (median 0.7, IQR 0.3–0.9) than in the PLMS (median 1.7, IQR 0.7–3.5) or the non-RSD/non-PLMS (median 2.0, IQR 0.8–4.5) groups. Conclusions: There was an elevated frequency of RSD and elevated PLMS in our cohort of children born prematurely. Children born prematurely are at higher risk of iron deficiency which can be a contributor factor to sleep -related movement disorders. These results add new knowledge regarding the prevalence of RSD and PLMS in these children.
- Published
- 2024
- Full Text
- View/download PDF
9. Targeting the adenosinergic system in restless legs syndrome: A pilot, 'proof-of-concept' placebo-controlled TMS-based protocol
- Author
-
Giuseppe Lanza, Michele Salemi, Maria P. Mogavero, Valentina Catania, Annalisa Galeano, Angelo Garifoli, Bartolo Lanuzza, Manuela Morreale, Mariangela Tripodi, Mariagiovanna Cantone, Francesco Cappellani, Carmen Concerto, Alessandro Rodolico, Manuela Pennisi, Rita Bella, and Raffaele Ferri
- Subjects
Medicine ,Science - Published
- 2024
10. Frequency of antidepressant use and clinical characteristics of children and adolescents undergoing polysomnography: an observational study
- Author
-
Lourdes M. DelRosso, Oliviero Bruni, Maria P. Mogavero, Amy Fickensher, Carlos H. Schenck, and Raffaele Ferri
- Subjects
Children ,Adolescents ,Antidepressants ,Sleep ,Polysomnography ,Periodic leg movements during sleep ,Pediatrics ,RJ1-570 ,Psychiatry ,RC435-571 - Abstract
Abstract Background Antidepressants are increasingly used in children for various psychiatric disorders but also for sleep disorders such as insomnia; however, it is currently unknown how many children undergoing polysomnography (PSG) are taking anti-depressants. The aims were: to determine the frequency of use of antidepressants in paediatric patients referred for PSG, to identify the most common antidepressants used, to investigate the reasons for their use, and to analyse the PSG parameters found in children taking antidepressants. Method An observational cross-sectional retrospective chart review of all children undergoing PSG at Seattle Children’s Hospital from 6/14/2020 to 12/8/2022 was carried out. Clinical features (such as diagnosis, especially psychiatric), sleep disorders (such as insomnia and restless sleep), and class of antidepressant used [selective serotonin reuptake inhibitors (SSRIs), serotonin and norepinephrine reuptake inhibitors (SNRIs), tricyclic antidepressants (TCA), or atypical antidepressants], and PSG parameters were collected for further analysis. Results Among 3,371 patients who underwent PSG during the study, 367 children were selected who were taking one antidepressant only (154 boys and 213 girls, mean age was 13.7 ± years 3.69). A significantly decreased sleep stage N3 was found in girls, who were older than boys. Children with insomnia had longer sleep latency than children without, but more N3. There was a prolonged rapid eye movement (REM) sleep latency in children with attention-deficit/hyperactivity disorder and children with autism. REM latency was longer and REM percentage smaller in children taking SNRIs. Periodic leg movement index ≥ 5/hour was found in a higher number of children taking SSRIs or SNRIs (24.9%) than in subjects taking TCA or atypical antidepressants (13.3%) (chi-square 5.29, p = 0.013). Conclusions Child and adolescent psychiatrists should question about the effects on sleep (both positive and negative) after initiating therapy with antidepressant medications.
- Published
- 2023
- Full Text
- View/download PDF
11. The Awakening of Sleep Medicine: A Global Quest for Quality Rest and Health
- Author
-
Raffaele Ferri
- Subjects
n/a ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
The burden of sleep disorders is a global health concern that affects millions of people worldwide [...]
- Published
- 2024
- Full Text
- View/download PDF
12. Mediterranean diet and chronotype: Data from Italian adults and systematic review of observational studies
- Author
-
Justyna Godos, Sabrina Castellano, Raffaele Ferri, Filippo Caraci, Giuseppe Lanza, Francesca Scazzina, Amer M. Alanazi, Wolfgang Marx, Fabio Galvano, and Giuseppe Grosso
- Subjects
Mediterranean diet ,Diet quality ,Chronotype ,Morningness ,Eveningness ,Medicine ,Biology (General) ,QH301-705.5 - Abstract
Scientific evidence suggests a relation between dietary factors and sleep. Several studies show that higher adherence to the Mediterranean diet is associated with better sleep quality, but the relation with chronotype has been only recently explored. The aim of this study was to better understand the relation between chronotype and Mediterranean diet adherence. For this purpose, an analysis of 1936 adults (age 18–90 y) living in Italy was performed to investigate the association between chronotype (assessed with a short form of the morningness-eveningness questionnaire) and adherence to the Mediterranean diet (assessed through a 110-item food frequency questionnaire and the Medi-Lite literature-based Mediterranean adherence score). A multivariate logistic regression analysis was conducted to calculate odds ratios (OR) and 95 % confidence intervals (CIs) describing the association between chronotypes and high adherence to the Mediterranean diet (>14 points). Moreover, a systematic review of other observational studies published so far was performed. Individuals reporting having intermediate (n = 614) and evening (n = 173) chronotypes were less likely to have high adherence to the Mediterranean diet compared to morning chronotype (OR = 0.28, 95 % CI: 0.18, 0.42 and OR = 0.08, 95 % CI: 0.03, 0.27, respectively). When the analysis was conducted in subgroups of age, the results were similar in mid-age (>50 y) participants (for intermediate and evening chronotypes, OR = 0.21, 95 % CI: 0.10, 0.43 and OR = 0.92, 95 % CI: 0.01, 0.69, respectively) while the association with high adherence to the Mediterranean diet of evening compared to morning chronotype lost significance in older (>60 y) participants (for intermediate and evening chronotypes, OR = 0.27, 95 % CI: 0.09, 0.82 and OR = 0.22, 95 % CI: 0.02, 1.92, respectively). Out of 10 studies (date range of publication 2020–2022) included in the systematic review, there was a general consistence of findings showing higher adherence to the Mediterranean diet among morning chronotypes, although few studies reported null results. In conclusion, current evidence suggests that an intermediate and evening chronotype could be associated with lower adherence to a Mediterranean diet, but the association could be modified by other factors when considering older individuals.
- Published
- 2023
- Full Text
- View/download PDF
13. Italian adaptation of the Uniform Data Set Neuropsychological Test Battery (I-UDSNB 1.0): development and normative data
- Author
-
Francesca Conca, Valentina Esposito, Francesco Rundo, Davide Quaranta, Cristina Muscio, Rosa Manenti, Giulia Caruso, Ugo Lucca, Alessia Antonella Galbussera, Sonia Di Tella, Francesca Baglio, Federica L’Abbate, Elisa Canu, Valentina Catania, Massimo Filippi, Giulia Mattavelli, Barbara Poletti, Vincenzo Silani, Raffaele Lodi, Maddalena De Matteis, Michelangelo Stanzani Maserati, Andrea Arighi, Emanuela Rotondo, Antonio Tanzilli, Andrea Pace, Federica Garramone, Carlo Cavaliere, Matteo Pardini, Cristiano Rizzetto, Sandro Sorbi, Roberta Perri, Pietro Tiraboschi, Nicola Canessa, Maria Cotelli, Raffaele Ferri, Sandra Weintraub, Camillo Marra, Fabrizio Tagliavini, Eleonora Catricalà, and Stefano Francesco Cappa
- Subjects
Neuropsychological tests ,UDS ,Alzheimer’s disease ,Cognition ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 ,Neurology. Diseases of the nervous system ,RC346-429 - Abstract
Abstract Background Neuropsychological testing plays a cardinal role in the diagnosis and monitoring of Alzheimer’s disease. A major concern is represented by the heterogeneity of the neuropsychological batteries currently adopted in memory clinics and healthcare centers. The current study aimed to solve this issue. Methods Following the initiative of the University of Washington’s National Alzheimer’s Coordinating Center (NACC), we presented the Italian adaptation of the Neuropsychological Test Battery of the Uniform Data Set (I-UDSNB). We collected data from 433 healthy Italian individuals and employed regression models to evaluate the impact of demographic variables on the performance, deriving the reference norms. Results Higher education and lower age were associated with a better performance in the majority of tests, while sex affected only fluency tests and Digit Span Forward. Conclusions The I-UDSNB offers a valuable and harmonized tool for neuropsychological testing in Italy, to be used in clinical and research settings.
- Published
- 2022
- Full Text
- View/download PDF
14. Sex-specific reference values for total, central, and peripheral latency of motor evoked potentials from a large cohort
- Author
-
Mariagiovanna Cantone, Giuseppe Lanza, Francesco Fisicaro, Rita Bella, Raffaele Ferri, Giovanni Pennisi, Gunnar Waterstraat, and Manuela Pennisi
- Subjects
central motor conduction time ,motor evoked potentials ,reference values ,transcranial magnetic stimulation ,sex ,physical variables ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
BackgroundDifferentiating between physiologic and altered motor evoked potentials (MEPs) to transcranial magnetic stimulation (TMS) is crucial in clinical practice. Some physical characteristics, such as height and age, introduce sources of variability unrelated to neural dysfunction. We provided new age- and height-adjusted normal values for cortical latency, central motor conduction time (CMCT), and peripheral motor conduction time (PMCT) from a large cohort of healthy subjects.MethodsPreviously reported data from 587 participants were re-analyzed. Nervous system disorders were ruled out by clinical examination and magnetic resonance imaging. MEP latency was determined as stimulus-to-response latency through stimulation with a circular coil over the “hot spot” of the First Dorsal Interosseous and Tibialis Anterior muscles, during mild tonic contraction. CMCT was estimated as the difference between MEP cortical latency and PMCT by radicular magnetic stimulation. Additionally, right-to-left differences were calculated. For each parameter, multiple linear regression models of increasing complexity were fitted using height, age, and sex as regressors.ResultsMotor evoked potential cortical latency, PMCT, and CMCT were shown to be age- and height-dependent, although age had only a small effect on CMCT. Relying on Bayesian information criterion for model selection, MEP cortical latency and PMCT were explained best by linear models indicating a positive correlation with both height and age. Also, CMCT to lower limbs positively correlated with height and age. CMCT to upper limbs positively correlated to height, but slightly inversely correlated to age, as supported by non-parametric bootstrap analysis. Males had longer cortical latencies and CMCT to lower limbs, as well as longer PMCT and cortical latencies to upper limbs, even when accounting for differences in body height. Right-to-left-differences were independent of height, age, and sex. Based on the selected regression models, sex-specific reference values were obtained for all TMS-related latencies and inter-side differences, with adjustments for height and age, where warranted.ConclusionA significant relationship was observed between height and age and all MEP latency values, in both upper and lower limbs. These set of reference values facilitate the evaluation of MEPs in clinical studies and research settings. Unlike previous reports, we also highlighted the contribution of sex.
- Published
- 2023
- Full Text
- View/download PDF
15. Mediterranean diet, mental health, cognitive status, quality of life, and successful aging in southern Italian older adults
- Author
-
Justyna Godos, Giuseppe Grosso, Raffaele Ferri, Filippo Caraci, Giuseppe Lanza, Wahidah H. Al-Qahtani, Giuseppe Caruso, and Sabrina Castellano
- Subjects
Successful aging ,Mediterranean diet ,Cognitive status ,Depressive symptoms ,Sleep quality ,Quality of life ,Medicine ,Biology (General) ,QH301-705.5 - Abstract
Healthy successful aging with preserved mental and cognitive health is expected to be one of the most important challenges of the growing old population globally. Studies investigating these multi-dimensional aspects of senescence are important to identify potential targets for early prevention. The aim of this study was to investigate the relation between adherence to the Mediterranean diet and mental and cognitive health, quality of life, and successful aging in middle-age and older adults living in Sicily, southern Italy. Data from a sample of 883 individuals was collected including information on food intake (through a 110-item food frequency questionnaire), sleep quality (through the Pittsburgh sleep quality index) depressive symptoms (through the Center for the Epidemiological Studies of Depression Short Form), quality of life (through the Manchester Short Assessment of Quality of Life), cognitive status (through the Short Portable Mental Status Questionnaire), and overall successful aging (through the Successful Aging Index). Multivariate logistic regression analyses were conducted to assess the association between adherence to the Mediterranean diet and the outcomes investigated. After adjustment for potential confounding factors, individuals in the highest quartile of adherence to the Mediterranean diet were less likely to have cognitive impairment (OR = 0.19, 95 % CI: 0.04, 0.86), depressive symptoms (OR = 0.19, 95 % CI: 0.08, 0.46) and more likely to have good quality of life (OR = 14.04, 95 % CI: 6.81, 28.93); significant results were also found for individuals in the third quartile of Mediterranean diet adherence and good sleep quality (OR = 1.65, 95 % CI: 1.03, 2.64). Moreover, individuals in the highest quartile of adherence were more likely to have a successful aging (OR = 1.65, 95 % CI: 1.01, 2.68). In conclusion, this study supports the hypothesis that adherence to the Mediterranean diet provides a positive trajectory toward a healthy successful aging, with major potential benefits toward mental and cognitive health.
- Published
- 2023
- Full Text
- View/download PDF
16. Gene Expression Profiling of Post Mortem Midbrain of Parkinson’s Disease Patients and Healthy Controls
- Author
-
Michele Salemi, Maria Ravo, Giuseppe Lanza, Francesca A. Schillaci, Giovanna Maria Ventola, Giovanna Marchese, Maria Grazia Salluzzo, Graziella Cappelletti, and Raffaele Ferri
- Subjects
mRNAs ,RNA sequencing ,Parkinson’s disease ,transcriptome analysis ,substantia nigra ,Biology (General) ,QH301-705.5 ,Chemistry ,QD1-999 - Abstract
Parkinson’s disease (PD) stands as the most prevalent degenerative movement disorder, marked by the degeneration of dopaminergic neurons in the substantia nigra of the midbrain. In this study, we conducted a transcriptome analysis utilizing post mortem mRNA extracted from the substantia nigra of both PD patients and healthy control (CTRL) individuals. Specifically, we acquired eight samples from individuals with PD and six samples from CTRL individuals, with no discernible pathology detected in the latter group. RNA sequencing was conducted using the TapeStation 4200 system from Agilent Technologies. A total of 16,148 transcripts were identified, with 92 mRNAs displaying differential expression between the PD and control groups. Specifically, 33 mRNAs were significantly up-regulated, while 59 mRNAs were down-regulated in PD compared to the controls. The identification of statistically significant signaling pathways, with an adjusted p-value threshold of 0.05, unveiled noteworthy insights. Specifically, the enriched categories included cardiac muscle contraction (involving genes such as ATPase Na+/K+ transporting subunit beta 2 (ATP1B2), solute carrier family 8 member A1 (SLC8A1), and cytochrome c oxidase subunit II (COX2)), GABAergic synapse (involving GABA type A receptor-associated protein-like 1 (GABARAPL1), G protein subunit beta 5 (GNB5), and solute carrier family 38 member 2 (SLC38A2), autophagy (involving GABARAPL1 and tumor protein p53-inducible nuclear protein 2 (TP53INP2)), and Fc gamma receptor (FcγR) mediated phagocytosis (involving amphiphysin (AMPH)). These findings uncover new pathophysiological dimensions underlying PD, implicating genes associated with heart muscle contraction. This knowledge enhances diagnostic accuracy and contributes to the advancement of targeted therapies.
- Published
- 2024
- Full Text
- View/download PDF
17. Mediterranean Diet and Sleep Features: A Systematic Review of Current Evidence
- Author
-
Justyna Godos, Raffaele Ferri, Giuseppe Lanza, Filippo Caraci, Angel Olider Rojas Vistorte, Vanessa Yelamos Torres, Giuseppe Grosso, and Sabrina Castellano
- Subjects
Mediterranean diet ,sleep ,insomnia ,daytime sleepiness ,observational studies ,Nutrition. Foods and food supply ,TX341-641 - Abstract
The prevalence of sleep disorders, characterized by issues with quality, timing, and sleep duration is increasing globally. Among modifiable risk factors, diet quality has been suggested to influence sleep features. The Mediterranean diet is considered a landmark dietary pattern in terms of quality and effects on human health. However, dietary habits characterized by this cultural heritage should also be considered in the context of overall lifestyle behaviors, including sleep habits. This study aimed to systematically revise the literature relating to adherence to the Mediterranean diet and sleep features in observational studies. The systematic review comprised 23 reports describing the relation between adherence to the Mediterranean diet and different sleep features, including sleep quality, sleep duration, daytime sleepiness, and insomnia symptoms. The majority of the included studies were conducted in the Mediterranean basin and reported a significant association between a higher adherence to the Mediterranean diet and a lower likelihood of having poor sleep quality, inadequate sleep duration, excessive daytime sleepiness or symptoms of insomnia. Interestingly, additional studies conducted outside the Mediterranean basin showed a relationship between the adoption of a Mediterranean-type diet and sleep quality, suggesting that biological mechanisms sustaining such an association may exist. In conclusion, current evidence suggests a relationship between adhering to the Mediterranean diet and overall sleep quality and different sleep parameters. The plausible bidirectional association should be further investigated to understand whether the promotion of a healthy diet could be used as a tool to improve sleep quality.
- Published
- 2024
- Full Text
- View/download PDF
18. Virtual Reality for the Rehabilitation of Acquired Cognitive Disorders: A Narrative Review
- Author
-
Valentina Catania, Francesco Rundo, Simonetta Panerai, and Raffaele Ferri
- Subjects
cognitive rehabilitation ,virtual reality ,serious game ,videogames ,attention ,executive functions ,Technology ,Biology (General) ,QH301-705.5 - Abstract
This review article explores the use of Virtual Reality (VR) technology in cognitive rehabilitation for individuals with neurological conditions, such as stroke, traumatic brain injury, and neurodegenerative diseases. The introduction highlights the challenges posed by cognitive impairments and the limitations of traditional rehabilitation methods. VR is presented as a transformative tool that immerses individuals in interactive environments, offering promising opportunities for enhancing cognitive functions and improving quality of life. This article covers the foundational principles of VR, its applications across different clinical conditions and cognitive domains, and evaluates empirical evidence supporting its efficacy. It also discusses the advantages, limitations, challenges, and ethical considerations in the use of VR for cognitive rehabilitation. This review concludes by exploring future developments, including advancements in VR technology, the integration of Augmented Reality (AR) and artificial intelligence (AI), and the importance of standardized assessment tools for the objective evaluation of rehabilitation outcomes.
- Published
- 2023
- Full Text
- View/download PDF
19. A Next-Generation Sequencing Study in a Cohort of Sicilian Patients with Parkinson’s Disease
- Author
-
Michele Salemi, Giuseppe Lanza, Maria Grazia Salluzzo, Francesca A. Schillaci, Francesco Domenico Di Blasi, Angela Cordella, Salvatore Caniglia, Bartolo Lanuzza, Manuela Morreale, Pietro Marano, Mariangela Tripodi, and Raffaele Ferri
- Subjects
Parkinson’s disease ,NGS ,movement disorders ,gene variants ,Biology (General) ,QH301-705.5 - Abstract
Parkinson’s disease (PD) is a multisystem and multifactorial disorder and, therefore, the application of modern genetic techniques may assist in unraveling its complex pathophysiology. We conducted a clinical–demographic evaluation of 126 patients with PD, all of whom were Caucasian and of Sicilian ancestry. DNA was extracted from the peripheral blood for each patient, followed by sequencing using a Next-Generation Sequencing system. This system was based on a custom gene panel comprising 162 genes. The sample underwent further filtering, taking into account the allele frequencies of genetic variants, their presence in the Human Gene Mutation Database, and their association in the literature with PD or other movement/neurodegenerative disorders. The largest number of variants was identified in the leucine-rich repeat kinase 2 (LRRK2) gene. However, variants in other genes, such as acid beta-glucosidase (GBA), DNA polymerase gamma catalytic subunit (POLG), and parkin RBR E3 ubiquitin protein ligase (PRKN), were also discovered. Interestingly, some of these variants had not been previously associated with PD. Enhancing our understanding of the genetic basis of PD and identifying new variants possibly linked to the disease will contribute to improved diagnostic accuracy, therapeutic developments, and prognostic insights for affected individuals.
- Published
- 2023
- Full Text
- View/download PDF
20. The supporting (sometimes decisive!) role of transcranial magnetic stimulation in forensic medicine
- Author
-
Francesco Fisicaro, Aldo Liberto, Giuseppe Lanza, Rita Bella, Giovanni Pennisi, Raffaele Ferri, Yasuo Terao, Yoshikazu Ugawa, and Manuela Pennisi
- Subjects
Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Published
- 2023
- Full Text
- View/download PDF
21. Parietal intrahemispheric source connectivity of resting-state electroencephalographic alpha rhythms is abnormal in Naïve HIV patients
- Author
-
Claudio Babiloni, Claudio Del Percio, Roberta Lizio, Susanna Lopez, Alfredo Pennica, Paolo Roma, Valentina Correr, Federica Cucciolla, Ginevra Toma, Andrea Soricelli, Francesco Di Campli, Antonio Aceti, Elisabetta Teti, Loredana Sarmati, Gloria Crocetti, Raffaele Ferri, Ivan Lorenzo, Massimo Galli, Cristina Negri, Gioacchino Angarano, Annalisa Saracino, Luciana Lepore, Massimo Di Pietro, Francesco Maria Fusco, Vincenzo Vullo, Gabriella D’Ettorre, Pasquale Pagliano, Giusy Di Flumeri, Benedetto Maurizio Celesia, Elio Gentilini Cacciola, Giovanni Di Perri, Andrea Calcagno, Fabrizio Stocchi, Stefano Ferracuti, Paolo Onorati, Massimo Andreoni, and Giuseppe Noce
- Subjects
Human immunodeficiency virus (HIV) ,Functional brain connectivity ,Resting-state EEG rhythms ,Exact Low-resolution brain electromagnetic source tomography (eLORETA) ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
Previous evidence showed abnormal parietal sources of resting-state electroencephalographic (EEG) delta (< 4 Hz) and alpha (8–12 Hz) rhythms in treatment-Naïve HIV (Naïve HIV) subjects, as cortical neural synchronization markers in quiet wakefulness. Here, we tested the hypothesis that these local abnormalities may be related to functional cortical dysconnectivity as an oscillatory brain network disorder.The present EEG database regarded 128 Naïve HIV and 60 Healthy subjects. The eLORETA freeware estimated lagged linear EEG source connectivity (LLC). The area under receiver operating characteristic (AUROC) curve indexed the accuracy in the classification between Healthy and HIV individuals.Parietal intrahemispheric LLC solutions in alpha sources were abnormally lower in the Naïve HIV than in the control group. Furthermore, those abnormalities were greater in the Naïve HIV subgroup with executive and visuospatial deficits than the Naïve HIV subgroup with normal cognition. AUROC curves of those LLC solutions exhibited moderate/good accuracies (0.75–0.88) in the discrimination between the Naïve HIV individuals with executive and visuospatial deficits vs. Naïve HIV individuals with normal cognition and control individuals.In quiet wakefulness, Naïve HIV subjects showed clinically relevant abnormalities in parietal alpha source connectivity. HIV may alter a parietal “hub” oscillating at the alpha frequency in quiet wakefulness as a brain network disorder.
- Published
- 2022
- Full Text
- View/download PDF
22. Correction: Italian adaptation of the Uniform Data Set Neuropsychological Test Battery (I‑UDSNB 1.0): development and normative data
- Author
-
Francesca Conca, Valentina Esposito, Francesco Rundo, Davide Quaranta, Cristina Muscio, Rosa Manenti, Giulia Caruso, Ugo Lucca, Alessia Antonella Galbussera, Sonia Di Tella, Francesca Baglio, Federica L’Abbate, Elisa Canu, Valentina Catania, Massimo Filippi, Giulia Mattavelli, Barbara Poletti, Vincenzo Silani, Raffaele Lodi, Maddalena De Matteis, Michelangelo Stanzani Maserati, Andrea Arighi, Emanuela Rotondo, Antonio Tanzilli, Andrea Pace, Federica Garramone, Carlo Cavaliere, Matteo Pardini, Cristiano Rizzetto, Sandro Sorbi, Roberta Perri, Pietro Tiraboschi, Nicola Canessa, Maria Cotelli, Raffaele Ferri, Sandra Weintraub, Camillo Marra, Fabrizio Tagliavini, Eleonora Catricalà, and Stefano Francesco Cappa
- Subjects
Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 ,Neurology. Diseases of the nervous system ,RC346-429 - Published
- 2023
- Full Text
- View/download PDF
23. LC-MS/MS Quantitation of HILIC-Enriched N-glycopeptides Derived from Low-Abundance Serum Glycoproteins in Patients with Narcolepsy Type 1
- Author
-
Mojgan Atashi, Cristian D. Gutierrez Reyes, Vishal Sandilya, Waziha Purba, Parisa Ahmadi, Md. Abdul Hakim, Firas Kobeissy, Giuseppe Plazzi, Monica Moresco, Bartolo Lanuzza, Raffaele Ferri, and Yehia Mechref
- Subjects
NT1 ,HILIC-enriched N-glycopeptides ,biomarker glycoproteins ,Microbiology ,QR1-502 - Abstract
Glycoproteomic analysis is always challenging because of low abundance and complex site-specific heterogeneity. Glycoproteins are involved in various biological processes such as cell signaling, adhesion, and cell–cell communication and may serve as potential biomarkers when analyzing different diseases. Here, we investigate glycoproteins in narcolepsy type 1 (NT1) disease, a form of narcolepsy characterized by cataplexy—the sudden onset of muscle paralysis that is typically triggered by intense emotions. In this study, 27 human blood serum samples were analyzed, 16 from NT1 patients and 11 from healthy individuals serving as controls. We quantified hydrophilic interaction liquid chromatography (HILIC)-enriched glycopeptides from low-abundance serum samples of controls and NT1 patients via LC-MS/MS. Twenty-eight unique N-glycopeptides showed significant changes between the two studied groups. The sialylated N-glycopeptide structures LPTQNITFQTESSVAEQEAEFQSPK HexNAc6, Hex3, Neu5Ac2 (derived from the ITIH4 protein) and the structure IVLDPSGSMNIYLVLDGSDSIGASNFTGAK HexNAc5, Hex4, Fuc1 (derived from the CFB protein), with p values of 0.008 and 0.01, respectively, were elevated in NT1 samples compared with controls. In addition, the N-glycopeptide protein sources Ceruloplasmin, Complement factor B, and ITH4 were observed to play an important role in the complement activation and acute-phase response signaling pathways. This may explain the possible association between the biomarkers and pathophysiological effects.
- Published
- 2023
- Full Text
- View/download PDF
24. Academic Skills in Students with Autism Spectrum Disorder and Intellectual Disability: A Systematic Review and Meta-Analysis
- Author
-
Francesco Domenico Di Blasi, Angela Antonia Costanzo, Maria Finocchiaro, Maria Agatina Stimoli, Rosa Zuccarello, Serafino Buono, Raffaele Ferri, and Pierluigi Zoccolotti
- Subjects
autism spectrum disorder ,intellectual disability ,academic achievement ,meta-analysis ,systematic review ,Education - Abstract
Background: A substantial proportion of children with autism spectrum disorder (ASD) also have an intellectual disability (ID). However, the academic achievement levels of students with ASD and ID (ASD-ID) are poorly documented and known. Method: We systematically reviewed studies on school skills (reading, spelling, and math) in children and adolescents with ASD-ID. The search was conducted in seven bibliographic databases: Embase, Pubmed/MEDLINE, PsycINFO, Cochrane Library, Ebscohost, Proquest, and Scopus until 28 May 2022. Results: We identified 33,750 reports, four of which met the inclusion criteria for the review. The studies, characterized by Level III evidence (non-randomized controlled trials), included 535 students, 266 in the ASD-ID group and 269 in the ASD-no ID group. A random-effects model meta-analysis revealed that students with ASD-ID had significantly lower reading, spelling, and math scores than students with ASD-no ID. The effect sizes associated with reading score differences were large, although with significant heterogeneity; similarly, the effect sizes associated with spelling and math score differences were also large, although to a lesser extent than for reading. Conclusions: The co-presence of ASD and ID is associated with significant deficits in reading, spelling, and math. However, the present meta-analytic results rest on a limited number of studies. This contrasts with the substantial proportion of children with ASD who have ID and highlights the need for further research to fill a significant gap regarding the profile of academic abilities of students with ASD-ID.
- Published
- 2023
- Full Text
- View/download PDF
25. Rethinking the Role of Orexin in the Regulation of REM Sleep and Appetite
- Author
-
Maria P. Mogavero, Justyna Godos, Giuseppe Grosso, Filippo Caraci, and Raffaele Ferri
- Subjects
orexin ,hypocretin ,REM sleep ,feeding ,appetite ,sleep ,Nutrition. Foods and food supply ,TX341-641 - Abstract
Orexin plays a significant role in the modulation of REM sleep, as well as in the regulation of appetite and feeding. This review explores, first, the current evidence on the role of orexin in the modulation of sleep and wakefulness and highlights that orexin should be considered essentially as a neurotransmitter inhibiting REM sleep and, to a much lesser extent, a wake promoting agent. Subsequently, the relationship between orexin, REM sleep, and appetite regulation is examined in detail, shedding light on their interconnected nature in both physiological conditions and diseases (such as narcolepsy, sleep-related eating disorder, idiopathic hypersomnia, and night eating syndrome). Understanding the intricate relationship between orexin, REM sleep, and appetite regulation is vital for unraveling the complex mechanisms underlying sleep-wake patterns and metabolic control. Further research in this field is encouraged in order to pave the way for novel therapeutic approaches to sleep disorders and metabolic conditions associated with orexin dysregulation.
- Published
- 2023
- Full Text
- View/download PDF
26. Sex differences in mild vascular cognitive impairment: A multimodal transcranial magnetic stimulation study.
- Author
-
Mariagiovanna Cantone, Francesco Fisicaro, Raffaele Ferri, Rita Bella, Giovanni Pennisi, Giuseppe Lanza, and Manuela Pennisi
- Subjects
Medicine ,Science - Abstract
BackgroundSex differences in vascular cognitive impairment (VCI) at risk for future dementia are still debatable. Transcranial magnetic stimulation (TMS) is used to evaluate cortical excitability and the underlying transmission pathways, although a direct comparison between males and females with mild VCI is lacking.MethodsSixty patients (33 females) underwent clinical, psychopathological, functional, and TMS assessment. Measures of interest consisted of: resting motor threshold, latency of motor evoked potentials (MEPs), contralateral silent period, amplitude ratio, central motor conduction time (CMCT), including the F wave technique (CMCT-F), short-interval intracortical inhibition (SICI), intracortical facilitation, and short-latency afferent inhibition, at different interstimulus intervals (ISIs).ResultsMales and females were comparable for age, education, vascular burden, and neuropsychiatric symptoms. Males scored worse at global cognitive tests, executive functioning, and independence scales. MEP latency was significantly longer in males, from both sides, as well CMCT and CMCT-F from the left hemisphere; a lower SICI at ISI of 3 ms from the right hemisphere was also found. After correction for demographic and anthropometric features, the effect of sex remained statistically significant for MEP latency, bilaterally, and for CMCT-F and SICI. The presence of diabetes, MEP latency bilaterally, and both CMCT and CMCT-F from the right hemisphere inversely correlated with executive functioning, whereas TMS did not correlate with vascular burden.ConclusionsWe confirm the worse cognitive profile and functional status of males with mild VCI compared to females and first highlight sex-specific changes in intracortical and cortico-spinal excitability to multimodal TMS in this population. This points to some TMS measures as potential markers of cognitive impairment, as well as targets for new drugs and neuromodulation therapies.
- Published
- 2023
- Full Text
- View/download PDF
27. Patients with Alzheimer’s disease dementia show partially preserved parietal ‘hubs’ modeled from resting-state alpha electroencephalographic rhythms
- Author
-
Susanna Lopez, Claudio Del Percio, Roberta Lizio, Giuseppe Noce, Alessandro Padovani, Flavio Nobili, Dario Arnaldi, Francesco Famà, Davide V. Moretti, Annachiara Cagnin, Giacomo Koch, Alberto Benussi, Marco Onofrj, Barbara Borroni, Andrea Soricelli, Raffaele Ferri, Carla Buttinelli, Franco Giubilei, Bahar Güntekin, Görsev Yener, Fabrizio Stocchi, Laura Vacca, Laura Bonanni, and Claudio Babiloni
- Subjects
resting-state eyes closed electroencephalographic (rseeg) rhythms ,alzheimer’s disease with dementia (add) ,interdependencies of rseeg rhythms ,linear lagged connectivity ,graph theory ,hub topology ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
IntroductionGraph theory models a network by its nodes (the fundamental unit by which graphs are formed) and connections. ‘Degree’ hubs reflect node centrality (the connection rate), while ‘connector’ hubs are those linked to several clusters of nodes (mainly long-range connections).MethodsHere, we compared hubs modeled from measures of interdependencies of between-electrode resting-state eyes-closed electroencephalography (rsEEG) rhythms in normal elderly (Nold) and Alzheimer’s disease dementia (ADD) participants. At least 5 min of rsEEG was recorded and analyzed. As ADD is considered a ‘network disease’ and is typically associated with abnormal rsEEG delta (
- Published
- 2023
- Full Text
- View/download PDF
28. Editorial: Nutrition and sleep medicine
- Author
-
Justyna Godos, Raffaele Ferri, and Giuseppe Grosso
- Subjects
nutrition ,diet ,sleep ,sleep disorders ,brain health ,Nutrition. Foods and food supply ,TX341-641 - Published
- 2022
- Full Text
- View/download PDF
29. Restless Sleep Disorder and the Role of Iron in Other Sleep-Related Movement Disorders and ADHD
- Author
-
Noemi Cameli, Annachiara Beatrice, Elisa Maria Colacino Cinnante, Claudia Gullace, Giuliana Lentini, Sara Occhipinti, Raffaele Ferri, and Oliviero Bruni
- Subjects
restless sleep disorder ,restless legs syndrome ,periodic limb movements ,iron deficiency ,iron supplementation ,ferritin ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
In the last few years, restless sleep has been described as the key element of many clinical issues in childhood, leading to the recognition of “restless sleep disorder” (RSD) as a new proposed diagnostic category. The essential aid of video-polysomnographic recordings enables detection and quantification of the “large muscle group movements” (such as limb movements and repositioning) frequently described by parents of children with RSD. Strong evidence links iron deficiency to the pathophysiology of sleep-related movement disorders such as RSD, restless legs syndrome, periodic limb movement disorder, and attention deficit hyperactivity disorder (ADHD) due to the important role played by the brain dopamine production system. Serum ferritin is the main parameter used to evaluate iron deficiency in patients with sleep-related movement disorders. Iron supplementation is recommended when the serum ferritin level is
- Published
- 2023
- Full Text
- View/download PDF
30. Severe restless legs syndrome in a family with Alport syndrome
- Author
-
Davide Sparasci, Andrea Rossinelli, Raffaele Ferri, Pietro Cippà, Andrea Rinaldi, and Mauro Manconi
- Subjects
Alport syndrome ,Restless legs syndrome ,Augmentation ,Chronic kidney disease ,Diseases of the genitourinary system. Urology ,RC870-923 - Abstract
Abstract Background Restless legs syndrome (RLS) is a common sleep-related movement disorder characterized by an urge to move the legs during inactivity, especially at evening-night. RLS is highly prevalent in patients with kidney failure and have an impact on quality of life, mood, sleep quality and overall on compliance to the dialysis. Alport syndrome (AS) is a rare inherited disease, predominantly X-linked, secondary to mutations in genes encoding α3, α4 or α5 chains of type IV collagen, and characterized by hematuria, chronic kidney disease, neurosensory deafness, and lenticonus. Case presentation Here we describe a family with a combination of X-linked AS and severe RLS accompanied by periodic limb movements during sleep (PLMS). In the first patient we identified, RLS was complicated by a paradoxical response to dopamine agonists named “augmentation”, leading to sleep disruption, hallucinations and five peritoneal perforations during the peritoneal dialysis due to the difficulty to rest still. Therapeutic adjustments and renal transplantation improved RLS and PLMS. In two brothers, severe RLS prevented a compliance with hemodialysis. Female family members carrying the mutation were also affected by RLS, while those without the mutations were RLS-free. Conclusions RLS has not been reported earlier in association with AS, but the peculiar combinations observed in this family will stimulate further clinical studies and motivate nephrologists to seek for RLS symptoms and sleep disturbances in AS patients.
- Published
- 2021
- Full Text
- View/download PDF
31. mRNA expression profiling of mitochondrial subunits in subjects with Parkinson’s disease
- Author
-
Michele Salemi, Filomena Cosentino, Giuseppe Lanza, Mariagiovanna Cantone, Maria Grazia Salluzzo, Giorgio Giurato, Eugenia Borgione, Giovanna Marchese, Sandro Santa Paola, Bartolo Lanuzza, Corrado Romano, and Raffaele Ferri
- Subjects
parkinson’s disease ,mitochondrial subunits ,next generation sequencing ,quantitative real-time polymerase chain reaction ,Medicine - Abstract
Introduction Parkinson’s disease (PD) is a common adult-onset neurodegenerative disorder caused by a progressive loss of dopaminergic neurons due to the accumulation of α-synuclein in the substantia nigra. Mitochondria are known to play a key role in cell respiratory function and bioenergetics. Indeed, mitochondrial dysfunction causes insufficient energy production required to satisfy the needs of several organs, especially the nervous system. However, the profiling of messenger RNA (mRNA) expression of mitochondrial subunits in PD has not been systematically investigated yet. Material and methods We explored the mRNA expression of mitochondrial DNA (mtDNA) encoded respiratory chain (RC) subunits in 43 PD patients and 43 normal controls (NC). Next generation sequencing analysis (NGS) was used and quantitative real-time polymerase chain reaction (qRT-PCR) assay was used for confirmation of the NGS results. Results All tested mitochondrial RC subunits were significantly over-expressed in subjects with PD compared to NC. In qRT-PCR the mean expression of all mitochondrial subunits had an expression level of at least 7 times compared to NC. Conclusions The over-expression of mitochondrial subunits in PD subjects with respect to NC might be secondary to a degeneration-related alteration of the mitochondrial structure and/or dynamics, or to the occurrence of a compensatory mechanism. The study of specific mRNA by peripheral blood mononuclear cells may provide a further diagnostic frame for early detection PD patients.
- Published
- 2021
- Full Text
- View/download PDF
32. The Role of Supplements and Over-the-Counter Products to Improve Sleep in Children: A Systematic Review
- Author
-
Alice Innocenti, Giuliana Lentini, Serena Rapacchietta, Paola Cinnirella, Maurizio Elia, Raffaele Ferri, and Oliviero Bruni
- Subjects
pediatric sleep disorder ,treatment ,tryptophan ,iron ,antihistamines ,theanine ,Biology (General) ,QH301-705.5 ,Chemistry ,QD1-999 - Abstract
The sleep–wake cycle is a complex multifactorial process involving several neurotransmitters, including acetylcholine, norepinephrine, serotonin, histamine, dopamine, orexin and GABA, that can be, in turn, regulated by different nutrients involved in their metabolic pathways. Although good sleep quality in children has been proven to be a key factor for optimal cognitive, physical and psychological development, a significant and ever-increasing percentage of the pediatric population suffers from sleep disorders. In children, behavioral interventions along with supplements are recommended as the first line treatment. This systematic review was conducted, according to the PRISMA guidelines, with the purpose of assessing the principal nutrients involved in the pathways of sleep-regulating neurotransmitters in children and adolescents. Our focus was the utilization of over the counter (OTC) products, specifically iron, hydroxytryptophan, theanine and antihistamines in the management of different pediatric sleep disorders with the intention of providing a practical guide for the clinician.
- Published
- 2023
- Full Text
- View/download PDF
33. The Y831C Mutation of the POLG Gene in Dementia
- Author
-
Eugenia Borgione, Mariangela Lo Giudice, Sandro Santa Paola, Marika Giuliano, Giuseppe Lanza, Mariagiovanna Cantone, Raffaele Ferri, and Carmela Scuderi
- Subjects
neurodegeneration ,movement disorders ,dementia ,POLG ,Y831C ,Biology (General) ,QH301-705.5 - Abstract
Background: The POLG gene encodes the catalytic subunit of DNA polymerase γ, which is crucial for mitochondrial DNA (mtDNA) repair and replication. Gene mutation alters the stability of mtDNA and is associated with several clinical presentations, such as dysarthria and ophthalmoplegia (SANDO), progressive external ophthalmoplegia (PEO), spinocerebellar ataxia and epilepsy (SCAE), Alpers syndrome, and sensory ataxic neuropathy. Recent evidence has also indicated that POLG mutations may be involved in some neurodegenerative disorders, although systematic screening is currently lacking. Methods: To investigate the frequency of POLG gene mutations in neurodegenerative disorders, we screened a group of 33 patients affected by neurodegenerative diseases, including Parkinson’s disease, some atypical parkinsonisms, and dementia of different types. Results: Mutational analysis revealed the presence of the heterozygous Y831C mutation in two patients, one with frontotemporal dementia and one with Lewy body dementia. The allele frequency of this mutation reported by the 1000 Genomes Project in the healthy population is 0.22%, while in our group of patients, it was 3.03%, thus showing a statistically significant difference between the two groups. Conclusions: Our results may expand the genotype-phenotype spectrum associated with mutations in the POLG gene and strengthen the hypothesis of a pathogenic role of the Y831C mutation in neurodegeneration.
- Published
- 2023
- Full Text
- View/download PDF
34. Dietary Fats and Cognitive Status in Italian Middle-Old Adults
- Author
-
Walter Currenti, Justyna Godos, Amer M. Alanazi, Giuseppe Lanza, Raffaele Ferri, Filippo Caraci, Giuseppe Grosso, Fabio Galvano, and Sabrina Castellano
- Subjects
dietary fats ,short chain fatty acids ,cognition ,mental health ,saturated fats ,cognitive impairment ,Nutrition. Foods and food supply ,TX341-641 - Abstract
The increase in life expectancy led to a significant rise in the prevalence of age-related neurological diseases, such as cognitive impairment, dementia, and Alzheimer’s disease. Although genetics certainly play a role, nutrition emerged as a key factor in maintaining optimal cognitive function among older adults. Therefore, the study aimed to investigate whether specific categories and subcategories of dietary fats, based on carbon-chain length, are associated with cognitive status in a cohort of 883 Italian participants over the age of 50. Methods: The intake of total, single class of dietary fat, such as saturated fatty acids (SFA), monounsaturated fatty acid (MUFA), and polyunsaturated fatty acid (PUFA), and also single fatty acids grouped according to carbon-chain length, were evaluated by food frequency questionnaires (FFQs). Cognitive health was assessed using the short portable mental status questionnaire (SPMSQ). Results: After adjustment for potential confounding factors subjects with a moderate consumption of both short-chain SFA (for Q2 vs. Q1, OR = 0.23, 95% CI: 0.08, 0.66) and middle-chain SFA specifically lauric acid (C12:0) intake (for Q2 vs. Q1, OR = 0.27, 95% CI: 0.09, 0.77) were less likely to suffer from cognitive impairment. Among single MUFAs, erucic acid (C22:1) intake resulted in an inverse association, in a linear way, with cognitive impairment (for Q4 vs. Q1, OR = 0.04, 95% CI: 0.00, 0.39). Conversely, moderate intake of linoleic acid (C18:2) was associated with cognitive impairment (Q3 vs. Q1, OR = 4.59, 95% CI: 1.51, 13.94). Regarding other PUFAs, individuals consuming moderate intake alpha linolenic acid (C18:3) were less likely to have cognitive impairment (for Q3 vs. Q1, OR = 0.19, 95% CI: 0.06, 0.64). Conclusions: Total SFA intake appeared to be inversely associated with cognitive impairment. Regarding specific subtypes of fatty acids, the results mostly referred to short- and middle-chain SFA. Further studies are needed to validate the results of the present study.
- Published
- 2023
- Full Text
- View/download PDF
35. Challenging the Pleiotropic Effects of Repetitive Transcranial Magnetic Stimulation in Geriatric Depression: A Multimodal Case Series Study
- Author
-
Vincenzo G. Nicoletti, Francesco Fisicaro, Eugenio Aguglia, Rita Bella, Damiano Calcagno, Mariagiovanna Cantone, Carmen Concerto, Raffaele Ferri, Ludovico Mineo, Giovanni Pennisi, Riccardo Ricceri, Alessandro Rodolico, Giulia Saitta, Giulia Torrisi, Giuseppe Lanza, and Manuela Pennisi
- Subjects
neuromodulation ,neural plasticity ,mood disorders ,neurotrophins ,non-pharmacological interventions ,cortical excitability ,Biology (General) ,QH301-705.5 - Abstract
Background: Although the antidepressant potential of repetitive transcranial magnetic stimulation (rTMS), the pleiotropic effects in geriatric depression (GD) are poorly investigated. We tested rTMS on depression, cognitive performance, growth/neurotrophic factors, cerebral blood flow (CBF) to transcranial Doppler sonography (TCD), and motor-evoked potentials (MEPs) to TMS in GD. Methods: In this case series study, six drug-resistant subjects (median age 68.0 years) underwent MEPs at baseline and after 3 weeks of 10 Hz rTMS on the left dorsolateral prefrontal cortex. The percentage change of serum nerve growth factor, vascular endothelial growth factor, brain-derived growth factor, insulin-like growth factor-1, and angiogenin was obtained. Assessments were performed at baseline, and at the end of rTMS; psychocognitive tests were also repeated after 1, 3, and 6 months. Results: Chronic cerebrovascular disease was evident in five patients. No adverse/undesirable effect was reported. An improvement in mood was observed after rTMS but not at follow-up. Electrophysiological data to TMS remained unchanged, except for an increase in the right median MEP amplitude. TCD and neurotrophic/growth factors did not change. Conclusions: We were unable to detect a relevant impact of high-frequency rTMS on mood, cognition, cortical microcircuits, neurotrophic/growth factors, and CBF. Cerebrovascular disease and exposure to multiple pharmacological treatments might have contributed.
- Published
- 2023
- Full Text
- View/download PDF
36. LC-MS/MS-Based Proteomics Approach for the Identification of Candidate Serum Biomarkers in Patients with Narcolepsy Type 1
- Author
-
Akeem Sanni, Mona Goli, Jingfu Zhao, Junyao Wang, Chloe Barsa, Samer El Hayek, Farid Talih, Bartolo Lanuzza, Firas Kobeissy, Giuseppe Plazzi, Monica Moresco, Stefania Mondello, Raffaele Ferri, and Yehia Mechref
- Subjects
autoimmunity ,NT1 ,pathophysiology ,serum-protein biomarkers ,orexin/hypocretin ,Microbiology ,QR1-502 - Abstract
Narcolepsy type 1 (NT1) is the most common type of narcolepsy known to be caused by the loss of specific neurons responsible for producing peptide neurotransmitters (orexins/hypocretins), resulting in a sleep-wake cycle disorder. It is characterized by its association with cataplexy and abnormalities in rapid eye movement. To date, no cure has been established for this life-threatening condition. Misdiagnosis of NT1 is also quite common, although it is not exceedingly rare. Therefore, successfully identifying candidate serum biomarkers for NT1 would be a head start for accurate diagnosis and development of therapeutics for this disorder. This study aims to identify such potential serum biomarkers. A depletion protocol was employed for 27 human serum samples (16 NT1 and 11 healthy controls), followed by applying LC-MS/MS bottom-up proteomics analysis, then LC-PRM-MS for validation. The comparison of the proteome profiles of the low-abundant proteins in the samples was then investigated based on age, sex, sample groups, and the presence of the Human Leukocyte Antigen (HLA) DQB1*0602 allele. The results were tracked to gene expression studies as well as system biology to identify key proteins and understand their relationship in the pathogenesis of NT1. Our results revealed 36 proteins significantly and differentially expressed. Among the impaired pathways and bioprocesses, the complement activation pathway is impaired by six of the differentially expressed proteins (DEPs). They are coded by the genes C2, CFB, C5, C1R, C1S, and MASP1, while 11 DEPs are involved in Acute Phase Response Signaling (APRS), which are coded by the genes FN1, AMBP, APOH, CFB, CP, ITIH2, C5, C2, F2, C1, and ITIH4. The combined AUCs of the downregulated and upregulated DEPs are 0.95 and 0.76, respectively. Overall, this study reveals potential serum-protein biomarkers of NT1 and explains the possible correlation between the biomarkers and pathophysiological effects, as well as important biochemical pathways involved in NT1.
- Published
- 2023
- Full Text
- View/download PDF
37. Electrophysiological and Neuropsychological Indices of Cognitive Dysfunction in Patients with Chronic Insomnia and Severe Benzodiazepine Use Disorder
- Author
-
Anna Castelnovo, Silvia Miano, Raffaele Ferri, Alberto Raggi, Michelangelo Maestri, Valentina Bottasini, Matteo Anelli, Marco Zucconi, Vincenza Castronovo, Luigi Ferini-Strambi, and Mauro Manconi
- Subjects
chronic insomnia ,executive functioning ,long-term benzodiazepine use ,mismatch negativity ,Oddball P300 ,psychophysiology ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
Benzodiazepine (BDZ) misuse is a growing health problem, with 1–2% of patients under BDZ treatment meeting the criteria for use disorder or dependence. Although BDZ addiction potential has been known for decades, much remains unknown its effects on brain functions. The aim of this study was to assess the neuropsychological and neurophysiological profile of a group of chronic insomniacs taking long-term high doses of benzodiazepine. We recruited 17 consecutive patients admitted to our third-level Sleep Medicine Unit for drug discontinuation (7 males, mean age 49.2 ± 11.2 years, mean education 13.7 ± 3.9 years, mean daily diazepam-equivalent BDZ: 238.1 ± 84.5 mg) and 17 gender/age-matched healthy controls (7 males, mean age 46.8 ± 14.1 years, mean education 13.5 ± 4.5 years). We performed a full neuropsychological evaluation of all subjects and recorded their scalp event-related potentials (Mismatch-Passive Oddball-Paradigm and Active Oddball P300 Paradigm). Patients with chronic insomnia and BDZ use disorder showed a profound frontal lobe executive dysfunction with significant impairment in the cognitive flexibility domain, in face of a preserved working, short and long-term memory. In patients, P300 amplitude tended to be smaller, mainly over the frontal regions, compared to controls. BDZ use disorder has a severe cognitive impact on chronic insomnia patients. Long-term high-dose BDZ intake should be carefully evaluated and managed by clinicians in this specific patient population, especially in relation to risky activities.
- Published
- 2023
- Full Text
- View/download PDF
38. Functional Living Skills in Patients with Major Neurocognitive Disorder Due to Degenerative or Non-Degenerative Conditions: Effectiveness of a Non-Immersive Virtual Reality Training
- Author
-
Simonetta Panerai, Valentina Catania, Francesco Rundo, Domenica Tasca, Sabrina Musso, Claudio Babiloni, Giuseppina Prestianni, Stefano Muratore, and Raffaele Ferri
- Subjects
virtual reality ,neurocognitive disorders ,degenerative dementia ,non-degenerative dementia ,functional living skills ,Chemical technology ,TP1-1185 - Abstract
Virtual reality has gained attention as an effective tool for cognitive, motor, and daily activity rehabilitation in patients with major neurocognitive disorder (M-NCD). The first objective of this study was to check for differences between M-NCD caused by degenerative and non-degenerative conditions (DC and NDC, respectively) in terms of relearning four functional living skills (FLSs), by means of a non-immersive virtual reality training (VRT). The second purpose was to verify whether spontaneous transfer from the virtual environment to the real environment occurred. Four FLS apps were developed in our institute (Information, Suitcase, Medicine, and Supermarket). A nonrandomized interventional study was carried out, comparing experimental and control groups (EG and CG, respectively). The study included three phases: in vivo test at T1; VRT at T2 only for EG; in vivo test at T3. During the in vivo test, the four FLSs were assessed in their natural environments. Both EG-DC and EG-NDC significantly improved in all of the VRT variable scores (the EG-NDC group seemed to show better outcomes than the EG-DC group). Moderate-to-high satisfaction with the VRT was reported. EG-DC and EG-NDC also enhanced their performances in the in vivo test. No statistically significant differences between them were found. CG-DC and CG-NDC improved only in the execution time of Information in the in vivo test. These findings confirm the ecological validity of VRT for FLSs.
- Published
- 2023
- Full Text
- View/download PDF
39. Late-onset oro-facial dyskinesia in Spinocerebellar Ataxia type 2: a case report
- Author
-
Floriana Giardina, Giuseppe Lanza, Francesco Calì, and Raffaele Ferri
- Subjects
Movement disorders ,Oro-facial dyskinesia ,Spinocerebellar ataxia ,Neurology. Diseases of the nervous system ,RC346-429 - Abstract
Abstract Background Genetic familiar causes of oro-facial dyskinesia are usually restricted to Huntington’s disease, whereas other causes are often missed or underestimated. Here, we report the case of late-onset oro-facial dyskinesia in an elderly patient with a genetic diagnosis of Spinocerebellar Ataxia type 2 (SCA2). Case presentation A 75-year-old man complained of progressive balance difficulty since the age of 60 years, associated with involuntary movements of the mouth and tongue over the last 3 months. No exposure to anti-dopaminergic agents, other neuroleptics, antidepressants, or other drugs was reported. Family history was positive for SCA2 (brother and the son of the brother). At rest, involuntary movements of the mouth and tongue were noted; they appeared partially suppressible and became more evident during stress and voluntary movements. Cognitive examination revealed frontal-executive dysfunction, memory impairment, and attention deficit. Brain magnetic resonance imaging (MRI) disclosed signs of posterior periventricular chronic cerebrovascular disease and a marked ponto-cerebellar atrophy, as confirmed by volumetric MRI analysis. A dopamine transporter imaging scan demonstrated a bilaterally reduced putamen and caudate nucleus uptake. Ataxin-2 (ATXN2) gene analysis revealed a 36 cytosine-adenine-guanine (CAG) repeat expansion, confirming the diagnosis of SCA2. Conclusions SCA2 should be considered among the possible causes of adult-onset oro-facial dyskinesia, especially when the family history suggests an inherited cerebellar disorder. Additional clinical features, including parkinsonism and motor neuron disease, may represent relevant cues for an early diagnosis and adequate management.
- Published
- 2020
- Full Text
- View/download PDF
40. Dietary Fats and Depressive Symptoms in Italian Adults
- Author
-
Walter Currenti, Justyna Godos, Amer M. Alanazi, Giuseppe Lanza, Raffaele Ferri, Filippo Caraci, Fabio Galvano, Sabrina Castellano, and Giuseppe Grosso
- Subjects
dietary fats ,fat ,monounsaturated fats ,polyunsaturated fats ,saturated fats ,short-chain fatty acids ,Nutrition. Foods and food supply ,TX341-641 - Abstract
Background: Depression represents one of the major causes of disability worldwide, with an important socioeconomic cost. Although many risk factors have been considered in its pathogenesis, nutrition seems to play a determinant role in its prevention. With regard to individual macronutrients, dietary fats and especially n-3 polyunsaturated fatty acids (n-3 PUFA) are the most studied. However, previous data about other dietary fatty acids, such as n-6 PUFA, are conflicting, and little is known about saturated fatty acids (SFA), especially when considering carbon chain length. Thus, we investigated whether single types and subtypes of dietary fats are related to depressive symptoms in Italian individuals living in the Mediterranean area. Methods: Dietary and socio-demographic data of 1572 individuals were analyzed. Food frequency questionnaires (FFQs) were used to determine the consumption of total dietary fat and each specific class of dietary fat, such as SFA, monounsaturated fatty acid (MUFA), and PUFA. The intake of fatty acids was also assessed according to the carbon-chain length of each single class. The Center for Epidemiologic Studies Depression Scale (CES-D) was used as a screening tool for depressive symptoms. Results: After adjustment for potential confounding factors, a significant inverse association between low/moderate levels of PUFA intake and depressive symptoms (Q2 vs. Q1, odds ratio (OR) = 0.60, 95% CI: 0.44, 0.84) was found. On the other hand, moderate saturated fat consumption was associated with depressive symptoms (Q3 vs. Q1, OR = 1.44, 95% CI: 1.02, 2.04). However, when considering carbon chain length, individuals with a lower to moderate intake of short-chain saturated fatty acids (SCSFA) and medium-chain saturated fatty acids (MCSFA) were less likely to have depressive symptoms (Q3 vs. Q1, OR = 0.48, 95% CI: 0.31, 0.75), while moderate intake of arachidic acid (C20:0) was directly associated with depressive symptoms (Q3 vs. Q1, OR = 1.87, 95% CI: 1.26, 2.77). Among single MUFAs, higher myristoleic acid (C14:1) intake was directly associated with depressive symptoms (Q4 vs. Q1, OR = 1.71, 95% CI: 1.12, 2.61), while moderate intake of erucic acid (C22:1) was associated with lower odds of having depressive symptoms (Q3 vs. Q1, OR = 0.54, 95% CI: 0.33, 0.86). When considering individual PUFAs, individuals with moderate and higher intakes of arachidonic acid (C20:4) were less likely to have depressive symptoms (OR = 0.64, 95% CI: 0.45, 0.91; OR = 0.59, 95% CI: 0.38, 0.91, respectively). Similarly, higher eicosapentaenoic acid (C20:5) intake was inversely associated with depressive symptoms (Q4 vs. Q1, OR = 0.35, 95% CI: 0.12, 0.98), while a significant association for docosahexaenoic acid (C22:6) was retrieved only for low intakes (Q2 vs. Q1, OR = 0.33, 95% CI: 0.12, 0.88). Conclusions: Dietary fat intake may be associated with depressive symptoms, underlying the importance of distinguishing between different fat types. This study confirms the pivotal role of PUFAs and reopens the debate on the role of saturated fatty acids, suggesting plausible effects of moderate intakes of short-chain fatty acids.
- Published
- 2023
- Full Text
- View/download PDF
41. Seroepidemiological Survey on the Impact of Smoking on SARS-CoV-2 Infection and COVID-19 Outcomes: Protocol for the Troina Study
- Author
-
Riccardo Polosa, Venera Tomaselli, Pietro Ferrara, Alba Corina Romeo, Sonja Rust, Daniela Saitta, Filippo Caraci, Corrado Romano, Murugesan Thangaraju, Pietro Zuccarello, Jed Rose, Giulio Giacomo Cantone, Margherita Ferrante, Jonathan Belsey, Fabio Cibella, Elisa Interlandi, and Raffaele Ferri
- Subjects
Medicine ,Computer applications to medicine. Medical informatics ,R858-859.7 - Abstract
BackgroundAfter the global spread of SARS-CoV-2, research has highlighted several aspects of the pandemic, focusing on clinical features and risk factors associated with infection and disease severity. However, emerging results on the role of smoking in SARS-CoV-2 infection susceptibility or COVID-19 outcomes are conflicting, and their robustness remains uncertain. ObjectiveIn this context, this study aims at quantifying the proportion of SARS-CoV-2 antibody seroprevalence, studying the changes in antibody levels over time, and analyzing the association between the biochemically verified smoking status and SARS-CoV-2 infection. MethodsThe research design involves a 6-month prospective cohort study with a serial sampling of the same individuals. Each participant will be surveyed about their demographics and COVID-19–related information, and blood sampling will be collected upon recruitment and at specified follow-up time points (ie, after 8 and 24 weeks). Blood samples will be screened for the presence of SARS-CoV-2–specific antibodies and serum cotinine, being the latter of the principal metabolite of nicotine, which will be used to assess participants’ smoking status. ResultsThe study is ongoing. It aims to find a higher antibody prevalence in individuals at high risk for viral exposure (ie, health care personnel) and to refine current estimates on the association between smoking status and SARS-CoV-2/COVID-19. ConclusionsThe added value of this research is that the current smoking status of the population to be studied will be biochemically verified to avoid the bias associated with self-reported smoking status. As such, the results from this survey may provide an actionable metric to study the role of smoking in SARS-CoV-2 infection and COVID-19 outcomes, and therefore to implement the most appropriate public health measures to control the pandemic. Results may also serve as a reference for future clinical research, and the methodology could be exploited in public health sectors and policies. International Registered Report Identifier (IRRID)DERR1-10.2196/32285
- Published
- 2021
- Full Text
- View/download PDF
42. A Review on P300 in Obsessive-Compulsive Disorder
- Author
-
Alberto Raggi, Giuseppe Lanza, and Raffaele Ferri
- Subjects
cortical hyperarousal ,information processing ,obsessive-compulsive disorder ,over-focused attention ,p300 ,translational neuroscience ,Psychiatry ,RC435-571 - Abstract
Neuropsychological studies indicate the presence of cognitive changes in patients with obsessive-compulsive disorder (OCD). Indeed, OCD may be included among the dysfunctions of the frontal lobes and their connections with the limbic system, associative cortex, and basal ganglia. P300 is a positive component of the human event-related potential (ERP); it is associated with processes of encoding, identification, and categorization constituting, as a whole, the superior cortical function of information processing. Thus, P300 explores several areas that are implicated in OCD pathophysiology. Our aim is to review all relevant studies on the P300 component of the human ERP in order to recognize any significant central nervous system (CNS) correlate of cognitive dysfunction in OCD. A PubMed-based literature search resulted in 35 articles assessing P300 in OCD and reporting neurophysiological correlates of response inhibition, cortical hyperarousal, and over-focused attention. A decreased P300 amplitude was reported in both adult and pediatric patients, with a trend toward normalization after pharmacological treatment. Source localization studies disclosed an association between P300 abnormalities and the functioning of brain regions involved in the pathophysiology of OCD. Moreover, studies converge on the evidence of neurophysiological dysfunction in the frontal areas with impairment of the normal inhibitory processes in OCD. At least some of these electrophysiological correlates might reflect the obsessive thoughts and compulsions that characterize this disorder. These findings may also support cognitive-behavioral therapy (CBT) approaches on over-focused attention and inflexibility of compulsive behaviors, which should be associated to pharmacological treatment in these patients.
- Published
- 2021
- Full Text
- View/download PDF
43. Role and Dysregulation of miRNA in Patients with Parkinson’s Disease
- Author
-
Michele Salemi, Giovanna Marchese, Giuseppe Lanza, Filomena I. I. Cosentino, Maria Grazia Salluzzo, Francesca A. Schillaci, Giovanna Maria Ventola, Angela Cordella, Maria Ravo, and Raffaele Ferri
- Subjects
Parkinson’s disease ,synucleinopathy ,microRNA ,miRNA ,miRNA sequencing ,ingenuity pathway analysis ,Biology (General) ,QH301-705.5 ,Chemistry ,QD1-999 - Abstract
Parkinson’s disease (PD) is a neurodegenerative synucleinopathy that has a not yet fully understood molecular pathomechanism behind it. The role of risk genes regulated by small non-coding RNAs, or microRNAs (miRNAs), has also been highlighted in PD, where they may influence disease progression and comorbidities. In this case-control study, we analyzed miRNAs on peripheral blood mononuclear cells by means of RNA-seq in 30 participants, with the aim of identifying miRNAs differentially expressed in PD compared to age-matched healthy controls. Additionally, we investigated the pathways influenced by differentially expressed miRNAs and assessed whether a specific pathway could potentially be associated with PD susceptibility (enrichment analyses performed using the Ingenuity Pathway Analysis tools). Overall, considering that the upregulation of miRNAs might be related with the downregulation of their messenger RNA targets, and vice versa, we found several putative targets of dysregulated miRNAs (i.e., upregulated: hsa-miR-1275, hsa-miR-23a-5p, hsa-miR-432-5p, hsa-miR-4433b-3p, and hsa-miR-4443; downregulated: hsa-miR-142-5p, hsa-miR-143-3p, hsa-miR-374a-3p, hsa-miR-542-3p, and hsa-miR-99a-5p). An inverse connection between cancer and neurodegeneration, called “inverse comorbidity”, has also been noted, showing that some genes or miRNAs may be expressed oppositely in neurodegenerative disorders and in some cancers. Therefore, it may be reasonable to consider these miRNAs as potential diagnostic markers and outcome measures.
- Published
- 2022
- Full Text
- View/download PDF
44. Assessment of Executive and Cognitive Functions in Children with Restless Sleep Disorder: A Pilot Study
- Author
-
Lourdes M. DelRosso, German Vega-Flores, Raffaele Ferri, Maria P. Mogavero, and Adele Diamond
- Subjects
restless sleep disorder ,selective attention ,pediatrics ,executive functions ,Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 - Abstract
Restless sleep disorder affects children and is characterized by frequent nocturnal movements, iron deficiency, and daytime symptoms such as poor school performance or behavioral problems. Although sleep parameters have been thoroughly studied and daytime sleepiness has been previously assessed, neurocognitive and executive functions have not. In this study, we evaluated neurocognitive functions in a group of 13 children diagnosed with restless sleep disorder using the National Institute of Health Toolbox (NIH toolbox). The mean age was 10.62 (S.D. 2.785). Among them, seven were male and six were female. The fully corrected T-scores (adjusted for demographic variables: age, ethnicity, and education level) showed the lowest values for the Flanker test (selective attention) and dimensional change card sorting test (cognitive flexibility and inhibitory control), with a very large effect size vs. the corresponding expected frequencies. For all the other tests, the average scores were 50; however, individual children scored low on pattern recognition and two composite scores (fluid and total). In conclusion, these data support the fact that cognitive functions are affected in children with restless sleep disorder, especially selective attention. Clinicians must recognize sleep disorders and daytime impairment in order to promptly intervene and prevent cognitive impairments.
- Published
- 2022
- Full Text
- View/download PDF
45. Biomarkers for REM sleep behavior disorder in idiopathic and narcoleptic patients
- Author
-
Elena Antelmi, Fabio Pizza, Vincenzo Donadio, Marco Filardi, Yuri L. Sosero, Alex Incensi, Stefano Vandi, Monica Moresco, Raffaele Ferri, Sara Marelli, Luigi Ferini‐Strambi, Rocco Liguori, and Giuseppe Plazzi
- Subjects
Neurosciences. Biological psychiatry. Neuropsychiatry ,RC321-571 ,Neurology. Diseases of the nervous system ,RC346-429 - Abstract
Abstract To search for discriminating biomarkers, 30 patients with idiopathic rapid‐eye‐movements sleep behavior disorder (iRBD) were compared with 17 patients with RBD within narcolepsy type 1. Both groups underwent extensive examinations, including skin biopsy searching for phosphorylated α‐synuclein deposits and whole‐night video‐polysomnography. Skin biopsy was positive for phosphorylated α‐synuclein deposits in 86.7% of iRBD patients and in none of narcoleptic patients. The analysis of video‐polysomnographic motor events showed differences in their occurrence throughout the night in the two groups. iRBD and RBD due to narcolepsy do have different clinical and pathological findings, confirming a different pathophysiology.
- Published
- 2019
- Full Text
- View/download PDF
46. Examples of Inverse Comorbidity between Cancer and Neurodegenerative Diseases: A Possible Role for Noncoding RNA
- Author
-
Michele Salemi, Maria Paola Mogavero, Giuseppe Lanza, Laura M. Mongioì, Aldo E. Calogero, and Raffaele Ferri
- Subjects
noncoding RNAs ,inverse comorbidity ,cancer ,neurodegenerative diseases ,Cytology ,QH573-671 - Abstract
Cancer is one of the most common causes of death; in parallel, the incidence and prevalence of central nervous system diseases are equally high. Among neurodegenerative diseases, Alzheimer’s dementia is the most common, while Parkinson’s disease (PD) is the second most frequent neurodegenerative disease. There is a significant amount of evidence on the complex biological connection between cancer and neurodegeneration. Noncoding RNAs (ncRNAs) are defined as transcribed nucleotides that perform a variety of regulatory functions. The mechanisms by which ncRNAs exert their functions are numerous and involve every aspect of cellular life. The same ncRNA can act in multiple ways, leading to different outcomes; in fact, a single ncRNA can participate in the pathogenesis of more than one disease—even if these seem very different, as cancer and neurodegenerative disorders are. The ncRNA activates specific pathways leading to one or the other clinical phenotype, sometimes with obvious mechanisms of inverse comorbidity. We aimed to collect from the existing literature examples of inverse comorbidity in which ncRNAs seem to play a key role. We also investigated the example of mir-519a-3p, and one of its target genes Poly (ADP-ribose) polymerase 1, for the inverse comorbidity mechanism between some cancers and PD. We believe it is very important to study the inverse comorbidity relationship between cancer and neurodegenerative diseases because it will help us to better assess these two major areas of human disease.
- Published
- 2022
- Full Text
- View/download PDF
47. Dietary Phytoestrogen Intake and Cognitive Status in Southern Italian Older Adults
- Author
-
Francesca Giampieri, Justyna Godos, Giuseppe Caruso, Marcin Owczarek, Joanna Jurek, Sabrina Castellano, Raffaele Ferri, Filippo Caraci, and Giuseppe Grosso
- Subjects
phytoestrogens ,isoflavones ,lignans ,genistein ,daidzein ,cohort ,Microbiology ,QR1-502 - Abstract
Background: Aging society faces significant health challenges, among which cognitive-related disorders are emerging. Diet quality has been recognized among the major contributors to the rising prevalence of cognitive disorders, with increasing evidence of the putative role of plant-based foods and their bioactive components, including polyphenols. Dietary polyphenols, including phytoestrogens, have been hypothesized to exert beneficial effects toward brain health through various molecular mechanisms. However, the evidence on the association between dietary phytoestrogen intake and cognitive function is limited. The aim of this study was to investigate the association between phytoestrogen intake and cognitive status in a cohort of older adults living in Sicily, Southern Italy. Methods: Dietary information from 883 individuals aged 50 years or older was collected through a validated food frequency questionnaire. Cognitive status was assessed through the Short Portable Mental Status Questionnaire. Results: The highest total isoflavone (including daidzein and genistein) intake was inversely associated with cognitive impairment compared to the lowest (odds ratio (OR) = 0.43, 95% confidence interval (CI): 0.20–0.92). Higher intake of total lignans and, consistently, all individual compounds (with the exception of secoisolariciresinol) were inversely associated with cognitive impairment only in the unadjusted model. Conclusions: A higher intake of phytoestrogens, especially isoflavones, was associated with a better cognitive status in a cohort of older Italian individuals living in Sicily. Taking into account the very low intake of isoflavones in Italian diets, it is noteworthy to further investigate selected populations with habitual consumption of such compounds to test whether these results may be generalized to the Italian population.
- Published
- 2022
- Full Text
- View/download PDF
48. Preserved central cholinergic functioning to transcranial magnetic stimulation in de novo patients with celiac disease.
- Author
-
Giuseppe Lanza, Francesco Fisicaro, Carmela Cinzia D'Agate, Raffaele Ferri, Mariagiovanna Cantone, Luca Falzone, Giovanni Pennisi, Rita Bella, Marios Hadjivassiliou, and Manuela Pennisi
- Subjects
Medicine ,Science - Abstract
BackgroundCeliac disease (CD) is now viewed as a systemic disease with multifaceted clinical manifestations. Among the extra-intestinal features, neurological and neuropsychiatric symptoms are still a diagnostic challenge, since they can precede or follow the diagnosis of CD. In particular, it is well known that some adults with CD may complain of cognitive symptoms, that improve when the gluten-free diet (GFD) is started, although they may re-appear after incidental gluten intake. Among the neurophysiological techniques, motor evoked potentials (MEPs) to transcranial magnetic stimulation (TMS) can non-invasively probe in vivo the excitation state of cortical areas and cortico-spinal conductivity, being also able to unveil preclinical impairment in several neurological and psychiatric disorders, as well as in some systemic diseases affecting the central nervous system (CNS), such as CD. We previously demonstrated an intracortical disinhibition and hyperfacilitation of MEP responses to TMS in newly diagnosed patients. However, no data are available on the central cholinergic functioning indexed by specific TMS measures, such as the short-latency afferent inhibition (SAI), which might represent the neurophysiological correlate of cognitive changes in CD patients, also at the preclinical level.MethodsCognitive and depressive symptoms were screened by means of the Montreal Cognitive Assessment (MoCA) and the 17-item Hamilton Depression Rating Scale (HDRS), respectively, in 15 consecutive de novo CD patients and 15 healthy controls. All patients were on normal diet at the time of the enrolment. Brain computed tomography (CT) was performed in all patients. SAI, recorded at two interstimulus intervals (2 and 8 ms), was assessed as the percentage amplitude ratio between the conditioned and the unconditioned MEP response. Resting motor threshold, MEP amplitude and latency, and central motor conduction time were also measured.ResultsThe two groups were comparable for age, sex, anthropometric features, and educational level. Brain CT ruled out intracranial calcifications and clear radiological abnormalities in all patients. Scores at MoCA and HDRS were significantly worse in patients than in controls. The comparison of TMS data between the two groups revealed no statistically significant difference for all measures, including SAI at both interstimulus intervals.ConclusionsCentral cholinergic functioning explored by the SAI of the motor cortex resulted to be not affected in these de novo CD patients compared to age-matched healthy controls. Although the statistically significant difference in MoCA, an overt cognitive impairment was not clinically evident in CD patients. Coherently, to date, no study based on TMS or other diagnostic techniques has shown any involvement of the central acetylcholine or the cholinergic fibers within the CNS in CD. This finding might add support to the vascular inflammation hypothesis underlying the so-called "gluten encephalopathy", which seems to be due to an aetiology different from that of the cholinergic dysfunction. Longitudinal studies correlating clinical, TMS, and neuroimaging data, both before and after GFD, are needed.
- Published
- 2021
- Full Text
- View/download PDF
49. Phenolic Acids and Prevention of Cognitive Decline: Polyphenols with a Neuroprotective Role in Cognitive Disorders and Alzheimer’s Disease
- Author
-
Giuseppe Caruso, Justyna Godos, Anna Privitera, Giuseppe Lanza, Sabrina Castellano, Alessio Chillemi, Oliviero Bruni, Raffaele Ferri, Filippo Caraci, and Giuseppe Grosso
- Subjects
polyphenols ,cognitive status ,Alzheimer disease ,neurodegeneration ,neuroprotection ,secondary prevention ,Nutrition. Foods and food supply ,TX341-641 - Abstract
Cognitive impairment, also known as cognitive decline, can occur gradually or suddenly and can be temporary or more permanent. It represents an increasingly important public health problem and can depend on normal aging or be linked to different neurodegenerative disorders, including Alzheimer’s disease (AD). It is now well-established that lifestyle factors including dietary patterns play an important role in healthy aging as well as in the prevention of cognitive decline in later life. Among the natural compounds, dietary polyphenols including phenolic acids have been recently the focus of major attention, with their supplementation being associated with better cognitive status and prevention of cognitive decline. Despite their therapeutic potential, human studies investigating the relation between phenolic acids intake and cognitive outcomes are rather scarce. In this review, we provide preclinical evidence that different dietary polyphenols such as rosmarinic acid, ellagic acid, and cinnamic aldehyde can exert neuroprotective and pro-cognitive activities through different molecular mechanisms including the modulation of pro-oxidant and antioxidant machinery as well as inflammatory status. Future and more numerous in vivo studies are needed to strengthen the promising results obtained at the preclinical level. Despite the excellent pharmacokinetic properties of phenolic acids, which are able to be accumulated in the brain at pharmacologically relevant levels, future studies should also identify which among the different metabolites produced as a consequence of phenolic acids’ consumption may be responsible for the potential neuroprotective effects of this subgroup of polyphenols.
- Published
- 2022
- Full Text
- View/download PDF
50. Abnormalities of Cortical Sources of Resting State Delta Electroencephalographic Rhythms Are Related to Epileptiform Activity in Patients With Amnesic Mild Cognitive Impairment Not Due to Alzheimer's Disease
- Author
-
Claudio Babiloni, Giuseppe Noce, Carlo Di Bonaventura, Roberta Lizio, Maria Teresa Pascarelli, Federico Tucci, Andrea Soricelli, Raffaele Ferri, Flavio Nobili, Francesco Famà, Eleonora Palma, Pierangelo Cifelli, Moira Marizzoni, Fabrizio Stocchi, Giovanni B. Frisoni, and Claudio Del Percio
- Subjects
amnesic mild cognitive impairment (aMCI) ,dementia ,alzheheimer's disease ,exact low-resolution brain electromagnetic source tomography (eLORETA) ,resting state electroencephalographic (rsEEG) rhythms ,epileptiform electroencephalographic activity (EEA) ,Neurology. Diseases of the nervous system ,RC346-429 - Abstract
In the present exploratory and retrospective study, we hypothesized that cortical sources of resting state eyes-closed electroencephalographic (rsEEG) rhythms might be more abnormal in patients with epileptiform EEG activity (spike-sharp wave discharges, giant spikes) and amnesic mild cognitive impairment not due to Alzheimer's disease (noADMCI-EEA) than matched noADMCI patients without EEA (noADMCI-noEEA). Clinical, neuroimaging, neuropsychological, and rsEEG data in 32 noADMCI and 30 normal elderly (Nold) subjects were available in a national archive. Age, gender, and education were carefully matched among them. No subject had received a clinical diagnosis of epilepsy. Individual alpha frequency peak (IAF) was used to determine the delta, theta, and alpha frequency bands of rsEEG rhythms. Fixed beta and gamma bands were also considered. Regional rsEEG cortical sources were estimated by eLORETA freeware. Area under receiver operating characteristic (AUROC) curves indexed the accuracy of eLORETA solutions in the classification between noADMCI-EEA and noADMCI-noEEA individuals. As novel findings, EEA was observed in 41% of noADMCI patients. Furthermore, these noADMCI-EEA patients showed higher temporal delta source activities as compared to noADMCI-no EEA patients and Nold subjects. Those activities discriminated individuals of the two NoADMCI groups with an accuracy of about 70%. The significant percentage of noADMCI-EEA patients showing EEA and marked abnormalities in temporal rsEEG rhythms at delta frequencies suggest a substantial role of underlying neural hypersynchronization mechanisms in their brain dysfunctions.
- Published
- 2020
- Full Text
- View/download PDF
Catalog
Discovery Service for Jio Institute Digital Library
For full access to our library's resources, please sign in.