Search

Polybrominated diphenyl ethers (PBDEs) are a class of persistent organic pollutants (POPs) used as flame retardants in the products utilized in day-to-day life. Their bioaccumulation, low volatility, and high persistence in the environment have led to their global spread even to remote and distant regions. The present study identifies gaps in the investigation of the neurotoxic potential of PBDEs, their effects on brain development, toxicokinetic, and their potential as a carcinogen. In India, to date, only human breast milk was assessed for levels of PBDEs, and it is suggested that other human tissues can also be explored. No data on the reproductive toxicity of PBDEs are reported from Indian cohorts. Long-range transport and deposition of PBDEs in colder regions necessitates monitoring of Himalayan regions in India. An inventory of PBDEs is required to be made for addressing the worrisome situation of the unregulated import of E-waste from the developed countries in India. The study also emphasizes providing guidelines for the articulation of policies regarding sound surveillance and management of PBDE production, consumption, and release in the Indian context. It is recommended that a separate cell for monitoring and follow-up of PBDEs should be established in India. Also, the development of better alternatives and environment-friendly remediation technologies for PBDEs is the need of the hour.

Polybrominated diphenyl ethers (PBDEs) are a class of persistent organic pollutants (POPs) used as flame retardants in the products utilized in day-to-day life. Their bioaccumulation, low volatility, and high persistence in the environment have led to their global spread even to remote and distant regions. The present study identifies gaps in the investigation of the neurotoxic potential of PBDEs, their effects on brain development, toxicokinetic, and their potential as a carcinogen. In India, to date, only human breast milk was assessed for levels of PBDEs, and it is suggested that other human tissues can also be explored. No data on the reproductive toxicity of PBDEs are reported from Indian cohorts. Long-range transport and deposition of PBDEs in colder regions necessitates monitoring of Himalayan regions in India. An inventory of PBDEs is required to be made for addressing the worrisome situation of the unregulated import of E-waste from the developed countries in India. The study also emphasizes providing guidelines for the articulation of policies regarding sound surveillance and management of PBDE production, consumption, and release in the Indian context. It is recommended that a separate cell for monitoring and follow-up of PBDEs should be established in India. Also, the development of better alternatives and environment-friendly remediation technologies for PBDEs is the need of the hour.

Prunus spp. and locally available plants (used as folkloric medicine) were screened to find a novel and natural anti-melanogenic agent. Based on p-protein promoter reporter assay (PPRA) the candidate plants were screened in the quest for p-protein inhibitor. Expression profiling of key proteins revealed the molecular mechanism of the melanin inhibition as well as TEM analysis revealed melanosome structure. The screened plant extract through PPRA showed significant down regulation of p-protein, which led to melanin inhibition. Another key melanosomal protein like tyrosinase and TRP-1 was also found to be down-regulated. However, TRP-2 was not affected. TEM analysis of treated cells also revealed that the stage IV melanosomes were lowered in number compared to control. The present study shows the plants used in this study possess good anti-melanogenic properties. However, the P. davidiana has the highest anti-melanogenic property among screened plant extracts.

The ionic liquids dubbed as green solvents have been demonstrated to be very effective in pre-treatment of various kinds of biomass for better saccharification. Present study describes ionic liquid stability of thermophilic Sporotrichum thermophile xylanase. It was active and stable in 1-ethyl-3-methylimidazolium acetate [EMIM][OAc] up to 50% concentration (v/v). The pre-treatment of wheat straw (18–25% (w/w) xylan) with [EMIM][OAc] followed by IL stable S. thermophile xylanase (containing 12 U/ml xylanase activity and 2 U/ml CMCase activity) treatment led to 281 mg reducing sugars (consisting of mainly xylose and xylo -oligosaccharides) per g wheat straw much higher as compared to non-pre-treated. IL stable enzymes enabled simultaneous pre-treatment, saccharification and the intermediate step of washing of residual IL can be eliminated to make the process cost effective. SEM, XRD and FT-IR confirmed the loss of crystallinity by [EMIM][OAc] pre-treatment followed by hydrolytic bond cleavage and deacylation by xylanase in the subsequent step.

Sophorolipids are a kind of glycolipid-based bio-surfactant, and some known yeasts can produce them by utilizing plant oil at elevated glucose. In spite of a high production yield, sophorolipids have a limited industrial application, due to their narrow range of HLB (hydrophile - lipophile balance) value. These molecules have regained the attention of researchers and industrialists due to their surface properties and versatile applicability in herbal medicine and cosmetics. The bioactivity and surface properties of sophorolipids are mainly governed by chain length and type of the fatty acid. Therefore, the present study was designed to produce and characterize sophorolipids with varying fatty acid chain lengths. Surface-properties like critical micelle concentration of produced sophorolipids were varying from 43 to 62 (dyne/cm). Foamability, dispersion power, and detergence were found to be higher for short chained fatty acids than the longer ones. Cleaning ability of sophorolipid for FLUX coated PCB was found to be better than the chemical surfactants. Biodegradation rates of the sophorolipids were found to be higher than of the linear alkylbenzene sulfonate (LAS) at room temperature as well as 4 oC. These results showed that the properties of sophorolipids can be tuned by varying the chain’s properties of fatty acids, and it may be possible to customize the properties of sophorolipids for specific industrial applications.

Peanut (Arachis hypogaea L.) is a major species of the family, Leguminosae, and economically important not only for vegetable oil but as a source of proteins, minerals and vitamins. It is widely grown in the semi-arid tropics and plays a role in the world agricultural economy. Peanut production and productivity is constrained by several biotic (insect pests and diseases) and abiotic (drought, salinity, water logging and temperature aberrations) stresses, as a result of which crop experiences serious economic losses. Genetic engineering techniques such as Agrobacterium tumefaciens and DNA-bombardment-mediated transformation are used as powerful tools to complement conventional breeding and expedite peanut improvement by the introduction of agronomically useful traits in high-yield background. Resistance to several fungal, virus and insect pest have been achieved through variety of approaches ranging from gene coding for cell wall component, pathogenesis-related proteins, oxalate oxidase, bacterial chloroperoxidase, coat proteins, RNA interference, crystal proteins etc. To develop transgenic plants withstanding major abiotic stresses, genes coding transcription factors for drought and salinity, cytokinin biosynthesis, nucleic acid processing, ion antiporter and human antiapoptotic have been used. Moreover, peanut has also been used in vaccine production for the control of several animal diseases. In addition to above, this study also presents a comprehensive account on the influence of some important factors on peanut genetic engineering. Future research thrusts not only suggest the use of different approaches for higher expression of transgene(s) but also provide a way forward for the improvement of crops.

Synthesis of caffeic acid ester essentially requires an efficient esterification process to produce various kinds of medicinally important ester derivatives. In the present study, a comprehensive and comparative analysis of whole-cell catalyzed caffeic acid esters production in ionic liquids (ILs) media was performed. Olive oil induced mycelial mass of halotolerant Aspergillus niger (A.niger) EXF 4321 was freeze dried and used as a catalyst. To ensure maximum solubilization of caffeic acid for highest substrate loading several ILs were screened and 1-ethyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide ([Emim][Tf 2 N]) was found to have the maximum solubility and favoured for enzymatic activity of freeze dried mycelia. The whole-cell catalyzed synthesis of caffeic acid phenethyl ester (CAPE) conditions were optimized and bioconversion up to 84% was achieved at a substrate molar ratio of 1:20 (caffeic acid:2-phenyl ethanol), 30 °C for 12 h. Results obtained during this study were encouraging and helpful to design a bioreactor system to produce caffeic acid derived esters.

An adequate knowledge on molecular mechanism of melanogenesis provides an opportunity to find the novel molecular targets for the discovery and development of new cosmetics. Among various genes, the OCA2 is being essential for proper melanin synthesis, and mutation or deletion of this gene leads to oculocutaneous albinism type 2. Thus, for this study, the product of this gene, that is P-protein, was targeted in quest for novel inhibitors as antimelanogenic agents. Based on pattern search of amino acid sequence and homology analysis, the protein structure was modelled. The role of this protein has been predicted as a tyrosine transporter of melanosomes. Thus, the molecular library was generated on the basis of tyrosine transporter inhibitor. Based on the dock score, 20 molecules have been considered as putative inhibitors for P-protein. Among these compounds, five molecules (compound #1, #4, #8, #13 and #17) were found to be quite effective as antimelanogenic without having any toxicity. Further investigations to establish the mechanism of action, the indirect methods such as tyrosinase assay, analysis for eumelanin and pheomelanins and investigation of mRNA levels were being carried out. The results from the studies offered a new lead in antimelanogenic therapy and may be very useful for further optimization work in developing them as novel depigmenting agents.

The present study was designed for the production and optimization of the C12-C14 sophorolipid, using the yeast Candida bombicola ATCC-22214. The fermentation was carried under fed-batch culture conditions i.e., maintaining 15% coconut oil and 10% glucose as hydrophobic and hydrophilic carbon sources, respectively. A maximum yield 54.0 g/L (in 234 h) was achieved. A significant antimicrobial activity, surface activity, and emulsion ability were recorded. The native sophorolipid was found as enhancer of detergent efficacy of commercial detergent, tested on complex, smudge and oil contaminated clothes. Molecular weight of the C12 (605/623) and C14 (633/651) sophorolipids were determined by LC-MS which revealed it as diacetylated sophorolipid. This study is being important in terms of yield, which is better than the previously reported.

Staphylococcus aureus, a Gram-positive bacterium, can cause a range of illnesses from minor skin infections to life-threatening diseases, such as bacteraemia, endocarditis, meningitis, osteomyelitis, pneumonia, toxic shock syndrome and sepsis. Due to the emergence of antibiotic resistance strains, there is a need to develop of new class of antibiotics or drug for this pathogen. The phosphotransacetylase enzyme plays an important role in the acetate metabolism and found to be essential for the survival of the S. aureus. This enzyme was evaluated as a putative drug target for S. aureus by in silico analysis. The 3D structure of the phosphotransacetylase from S. aureus was modelled, using the 1TD9 chain 'A' from Bacillus subtilis as a template at the resolution of 2.75 Å. The generated model has been validated by PROCHECK, WHAT IF and SuperPose. The docking was performed by the Molegro virtual docker using the ZINC database generated ligand library. The ligand library was generated within the limitation of the Lipinski rule of five. Based on the dock-score, five molecules have been subjected to ADME/TOX analysis and subjected for pharmacophore model generation. The zinc IDs of the potential inhibitors are ZINC08442078, ZINC8442200, ZINC 8442087 and ZINC 8442184 and found to be pharmacologically active antagonist of phosphotransacetylase. The molecules were evaluated as no-carcinogenic and persistent molecule by START programme.

Fucoidan is a complex-sulfated polysaccharide distributed in various marine organisms, and the brown algae are reported as the major producer. The fucoidan is important for their high bioactive properties, like antibacterial, anticoagulant, antiviral, anti-tumor, etc., and many more to be explored. There is a strong archival support for the bioactivity and promising properties of this molecule, which creates a hope for this molecule as future drug against thrombosis and some kind of cancers. Reports other than the above bioactive properties have also been a matter of interest for the design of signal or enzyme-arrested new class of drugs. In the past three decades, the research on isolation, molecular characterization, and screening of biological applications has significantly increased. One major issue associated with this molecule is the higher size and seasonal variation in their chemical composition; to resolve the issue and maintain its bioactivity, a prioritized and literal hydrolysis process is required to be developed. Here, in this mini-review, we have tried to summarize the algal fucoidan research and the bioactivities influenced by their molecular size.

A total of 49 protein sequences of alkaline proteases retrieved from GenBank representing different species of Aspergillus have been characterized for various physiochemical properties, homology search, multiple sequence alignment, motif, and super family search and phylogenetic tree construction. The sequence level homology was obtained among different groups of alkaline protease enzymes, viz alkaline serine protease, oryzin, calpain-like protease, serine protease, subtilisin-like alkaline proteases. Multiple sequence alignment of alkaline protease protein sequence of different Aspergillus species revealed a stretch of conserved region for amino acid residues from 69 to 110 and 130-204. The phylogenetic tree constructed indicated several Aspergillus species-specific clusters for alkaline proteases namely Aspergillus fumigatus, Aspergillus niger, Aspergillus oryzae, Aspergillus clavatus. The distributions of ten commonly observed motifs were analyzed among these proteases. Motif 1 with a signature amino acid sequence of 50 amino acids, i.e., ASFSNYGKVVDIFAPGQDILSCWIGSTTATNTISGTSMATPHIVGLSCYL, was uniformly observed in proteases protein sequences indicating its involvement with the structure and enzymatic function. Motif analysis of acidic proteases of Aspergillus and bacterial alkaline proteases has revealed different signature amino acid sequences. The superfamily search for these proteases revealed the presence of subtilases, serine-carboxyl proteinase, calpain large subunit, and thermolysin-like superfamilies with 45 representing the subtilases superfamily.

The pink-eyed dilution protein (P-protein) plays a critical role in melanin synthesis in melanocytes and retinal pigment epithelium cells. Mutation in this protein may cause complete or partial albinism. Role of the P-protein ranges in melanin synthesis to maturation and trafficking of the melanosomes. The aim of the present study was to evaluate the effect of P-protein inhibition on melanosome biology by comparing the shape, size, count, and types of melanosomes in melan-a melanocytes. The cells were extensively examined by the transmission electron microscopy. The P-protein inhibition was carried by P-protein-siRNA transfection to melan-a melanocytes, B16F10 mouse melanoma, and melan-p1 cells. Measurement of melanin contents, cellular tyrosinase, and different tyrosinase related proteins were also determined to investigate the effect of P-protein siRNA transfection on melanocytes. Results suggested that the inhibition of P-protein can significantly change the melanosomal morphology, types and their respective numbers, and provided a novel strategy for the control of melanin synthesis.

Sugar fatty acid esters are bio-surfactants known for their non-toxic, non-ionic, and high biodegradability . With great emulsifying and conditioning effects, sugar fatty acids are widely used in the food, pharmaceutical, and cosmetic industries. Biosynthesis of sugar fatty acid esters has attracted growing attention in recent decades. In this study, the enzymatic synthesis of sugar fatty acid esters in ionic liquids was developed, optimized, and scaled up. Reaction parameters affecting the conversion yield of lipase-catalyzed synthesis of glucose laurate from glucose and vinyl laurate (i.e. temperature, vinyl laurate/glucose molar ratio, and enzyme loads) were optimized by response surface methodology (RSM). In addition, production was scaled up to 2.5 L, and recycling of enzyme and ionic liquids was investigated. The results showed that under optimal reaction conditions (66.86 °C, vinyl laurate/glucose molar ratio of 7.63, enzyme load of 73.33 g/L), an experimental conversion yield of 96.4% was obtained which is close to the optimal value predicted by RSM (97.16%). A similar conversion yield was maintained when the reaction was carried out at 2.5 L. Moreover, the enzymes and ionic liquids could be recycled and reused effectively for up to 10 cycles. The results indicate the feasibility of ionic liquids as novel solvents for the biosynthesis of sugar fatty acid esters.

Recombination is one of the keys factor in evolutionary processes, involved in shaping the architecture of genomes and consequent phenotype. Understanding the recombination phenomenon especially among viruses will help in disease management. The present study aimed for in-silico analysis of recombination phenomenon among Begomoviruses, particularly emphasizing on viruses strains reported from India and neighboring countries. A total of 956 virus sequences have been used in this study. The Tomato yellow leaf curl China viruses, namely $$\hbox {gi}\vert 29825986\vert ;\hbox { gi}\vert 283468151\vert ; \hbox { gi}\vert 190559151\vert$$ and $$\hbox {gi}\vert 61652782\vert$$ were identified with the highest number of recombination event (1273). However, the Mung bean yellow mosaic India virus $$(\hbox {gi}\vert 66351988\vert )$$ was found to have 1170 recombination event. The phylogenic analysis among the highly recombinant sequences was carried to get an insight of the evolution among viral sequences in this class of plant viruses. The phylogenetic analysis revealed a pattern in diversity among these virus strains and a split tree analysis showed diversity in the range of 0.049128335–10.269852. This in silico analysis may pave way for a greater understanding of recombination phenomenon in geminiviruses and it might be helpful for strategic plant viral disease management.

Recently, the interest in mimicking functions of chalcogen-based catalytic antioxidants like selenoenzymes, has been increased. Various attempts had been done with selenium, but very few attempts were carried out with tellurium. Bio-complex formation and characterization of tellurium was not tried earlier by using any organism. The present study was focused on tellurium peptide production, characterization, and bioactivity assessment especially Mimetic to glutathione peroxidase (GPx). The production was achieved by the autolysis of total proteins obtained from Saccharomyces cerevisiae ATCC 7752 grown with inorganic tellurium. The GPx-like activity of the hydrolyzed tellurium peptide was increased when prepared by autolysis, but decreased when prepared by acid hydrolysis. Tellurium peptide produced by autolysis of the yeast cell showed increased GPx-like activity as well as tellurium content. Tellurium peptide showed little toxicity, compared to highly toxic inorganic tellurium. The results showed the potential of tellurium peptide as an antioxidant that can be produced by simple autolysis of yeast cells.

A total of 129 proteases sequences comprising 43 serine proteases, 36 aspartic proteases, 24 cysteine protease, 21 metalloproteases, and 05 neutral proteases from different Aspergillus species were analyzed for the catalytically active site residues using MEROPS database and various bioinformatics tools. Different proteases have predominance of variable active site residues. In case of 24 cysteine proteases of Aspergilli, the predominant active site residues observed were Gln193, Cys199, His364, Asn384 while for 43 serine proteases, the active site residues namely Asp164, His193, Asn284, Ser349 and Asp325, His357, Asn454, Ser519 were frequently observed. The analysis of 21 metalloproteases of Aspergilli revealed Glu298 and Glu388, Tyr476 as predominant active site residues. In general, Aspergilli species-specific active site residues were observed for different types of protease sequences analyzed. The phylogenetic analysis of these 129 proteases sequences revealed 14 different clans representing different types of proteases with diverse active site residues.

Melanin synthesis is a complex phenomenon which involves about 192 known gene products. Among them, MITF is a key transcription factor for tyrosinase, Trp1 and Trp2 proteins, which are essential for melanin biosynthesis. Thus, intervening inhibitor for the MITF-E-box complex formation can downregulate melanin synthesis. The focus of the present study is to develop a surface plasmon resonance-based system to screen the MITF-E-box complex inhibitor. The standardization of the MITF and E-box binding assay was calibrated for kinetics and specificity, in the presence of a pre-incubated 22 mer sequence containing mutated E-box (CTTGAG) along MITF. The binding assay with C17 was optimized and the steady-state kinetics was evaluated. C17 was identified as inhibitor to MITF-E-box, by virtual screening followed by in vitro assessment and EMSA assay. The k(a) and k(d) were found to be 5.5 9 103 M⁻¹ s⁻¹ and 0.0014 s⁻¹, respectively, while the steady-state association constant (K(A)) was 3.928 9 106 M⁻¹. The resonance variations after inhibition were quantified and analyzed to develop the standard method for screening of microphthalmia transcription factor-E-box binding inhibitor.

Sophorolipids, a kind of glycolipids, regarded as the most promising bio-surfactant, are synthesized by a selected number of yeast species. Instead of offering, as an environmental friendly alternative to the petrochemical based surfactants, it also exhibits various bioactivities. Sophorolipids in particular are on the brink of being incorporated into several cosmetic application. The potential of this molecule is also screened in various industries like the cosmetics, pharmaceuticals, and other medical applications. In this review, our aim is to provide an overview and updates on basic and applied research on Sophorolipid especially in terms of cosmetics and medicinal uses.

The microbial intervention for sustainable management of aquaculture, especially use of probiotics, is one of the most popular and practical approaches towards controlling pathogens. Vibrio harveyi is a well-known pathogenic bacterium, which is associated to a huge economic loss in the aquaculture system by causing vibriosis. The present study is crafted for screening and characterization of anti-Vibrio strains, which were isolated from various traditional fermented Korean foods. A total of 196 strains have been isolated from soybean paste (78 strains), red chili paste (49 strains), soy sauce (18 strains), jeotgal-a salted fish (34 strains), and the gazami crab-Portunus trituberculatus (17 strains). Fifteen strains showed an inhibitory effect on the growth of V. harveyi when subjected to coculture condition. Among the strains isolated, one has been identified as a significant anti-Vibrio strain. Further biochemical characterization and 16S rDNA sequencing revealed it as Pseudoalteromonas aliena, which had been deposited at the Korean Culture Center of Microorganisms (KCCM), Korea and designated as KCCM 11207P. The culture supernatants did not have any antimicrobial properties either in pure or in coculture condition. The culture supernatant was not toxic when supplemented to the swimming crab, Zoea, and Artemia larvae in aquaculture system. The results were very encouraging and showed a significant reduction in accumulated mortality. Here, we reported that pathogenic vibriosis can be controlled by Pseudoalteromonas sp. under in vitro and in vivo conditions. The results indicated that the biotic treatment offers a promising alternative to the use of antibiotics in crab aquaculture.

Aspergillus is a leading causative agent for fungal morbidity and mortality in immuno-compromised patients. To identify a putative target to design or identify new antifungal drug, against Aspergillus is required. In our previous work, we have analyzed the various biochemical pathways, and we found Ketol Acid Reducto-Isomerase (KARI) an enzyme involves in the amino acid biosynthesis, could be a better target. This enzyme was found to be unique by comparing to host proteome through BLASTp analysis. A homology based model of KARI was generated by Swiss model server. The generated model had been validated by PROCHECK and WHAT IF programs. The Zinc library was generated within the limitation of the Lipinski rule of five, for docking study. Based on the dock-score six molecules have been studied for ADME/TOX analysis and subjected for pharmacophore model generation. The Zinc ID of the potential inhibitors is ZINC00720614, ZINC01068126, ZINC0923, ZINC02090678, ZINC00663057 and ZINC02284065 and found to be pharmacologically active agonist and antagonist of KARI. This study is an attempt to Insilco evaluation of the KARI as a drug target and the screened inhibitors could help in the development of the better drug against Aspergillus.

Staphylococcus aureus is one of the most important and studied gram positive bacterial strains, which have a great potential to infect human beings as well as other mammals. The hospital-acquired methicillin-resistant, vancomycinsusceptible gram–positive bacteria strain is responsible for much life threatening diseases like Toxic-shock syndrome, staphylococcal scarlet fever, meningitis, osteomyelitis, etc. This antibiotic resistance strain, lead to development of the new antibiotics or drug molecules which can kill or suppress the growth of Staphylococcus aureus. We have performed an insilico comparative analysis of metabolic pathways of the host Homo sapiens and the pathogen S. aureus. The e-value threshold cut-off was set to 0.005. We have identifi ed total 235 enzyme sequences, which are non homologous to Homo sapiens protein sequences and among them 59 enzymes are found to be essential for survival of the S. aureus according to the DEG database. Further PA-SUB analysis Results showed that about 52.5% enzymes are found to be in the cytoplasm, 13.5% enzymes are found to be in extracellular, 6.7% enzymes are plasma membrane protein and 27.1% enzymes are given no positive prediction. In this comparative analysis, we have also found 5 unique pathways among 59 essential and 23 non homologous enzymes.