Back to Search Start Over

Neurobiochemical, Peptidomic, and Bioinformatic Approaches to Characterize Tauopathy Peptidome Biomarker Candidates in Experimental Mouse Model of Traumatic Brain Injury.

Authors :
Yadikar, Hamad
Johnson, Connor
Pafundi, Niko
Nguyen, Lynn
Kurup, Milin
Torres, Isabel
Al-Enezy, Albandery
Yang, Zhihui
Yost, Richard
Kobeissy, Firas H.
Wang, Kevin K. W.
Source :
Molecular Neurobiology; Apr2023, Vol. 60 Issue 4, p2295-2319, 25p
Publication Year :
2023

Abstract

Traumatic brain injury (TBI) is a multidimensional damage, and currently, no FDA-approved medicine is available. Multiple pathways in the cell are triggered through a head injury (e.g., calpain and caspase activation), which truncate tau and generate variable fragment sizes (MW 400–45,000 K). In this study, we used an open-head TBI mouse model generated by controlled cortical impact (CCI) and collected ipsilateral (IC) and contralateral (CC) mice htau brain cortices at one (D1) three (D3), and seven (D7) days post-injury. We implemented immunological (antibody-based detection) and peptidomic approaches (nano-reversed-phase liquid chromatography/tandem mass spectrometry) to investigate proteolytic tau peptidome (low molecular weight (LMW) < 10 K)) and pathological phosphorylation sites (high-molecular-weight (HMW); > 10 K) derived from CCI-TBI animal models. Our immunoblotting analysis verified tau hyperphosphorylation, HMW, and HMW breakdown products (HMW-BDP) formation of tau (e.g., pSer<subscript>202</subscript>, pThr<subscript>181</subscript>, pThr<subscript>231</subscript>, pSer<subscript>396</subscript>, and pSer<subscript>404</subscript>), following CCI-TBI. Peptidomic data revealed unique sequences of injury-dependent proteolytic peptides generated from human tau protein. Among the N-terminal tau peptides, EIPEGTTAEEAGIGDTPSLEDEAAGHVTQA (a.a. 96–125) and AQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARM (a.a. 91–127). Examples of tau C-terminal peptides identified include NVSSTGSIDMVDSPQLATLADEVSASLAKQGL (a.a. 410–441) and QLATLADEVSASLAKQGL (a.a. 424–441). Our peptidomic bioinformatic tools showed the association of proteases, such as CAPN1, CAPN2, and CTSL; CASP1, MMP7, and MMP9; and ELANE, GZMA, and MEP1A, in CCI-TBI tau peptidome. In clinical trials for novel TBI treatments, it might be useful to monitor a subset of tau peptidome as targets for biomarker utility and use them for a "theranostic" approach. [ABSTRACT FROM AUTHOR]

Details

Language :
English
ISSN :
08937648
Volume :
60
Issue :
4
Database :
Complementary Index
Journal :
Molecular Neurobiology
Publication Type :
Academic Journal
Accession number :
162235227
Full Text :
https://doi.org/10.1007/s12035-022-03165-y