Search

Hollow cross-linked enzyme aggregates of laccase (h-CLEA laccase) can be prepared by employing a millifluidic reactor carrying two coaxial laminar flows. In a confluence zone where acetonitrile and an aqueous solution of laccase meet, diffusion of acetonitrile into the aqueous solution gives rise to rapid precipitation of laccase aggregates at the water/acetonitrile interface, as is evidenced by fluorescence images. By controlling the flow rates carefully in the laminar flow regions, h-CLEA laccase around 220±10nm can be obtained, and the size of the h-CLEA laccase increases with increasing flow rates of both solutions. The h-CLEA laccase particles are distinctly different from CLEA laccase prepared in batch processes. The former only consist a crust of cross-linked enzymes (with a hollow core) whereas the latter has a highly porous structure. When the h-CLEA laccase is used as biocatalysts, their activity (0.26U/mg) is comparable to that of free enzymes at neutral pH due to the hollow structure. Moreover, the activity of h-CLEA laccase is higher than that of free laccase at high pH. For example, trypan blue (a dye molecule) can be decolorized completely in the presence of h-CLEA laccase within 270min even at pH 10.0, at which the free enzyme completely loses its activity. Because of their uniform sizes, h-CLEA laccase can be trapped in a membrane for continuous degradation of trypan blue up to 96h without losing any activity. This study shows the superiority of h-CLEA laccase compared to other types of immobilized enzymes., (Copyright © 2016 Elsevier B.V. All rights reserved.)

Entrapment of enzymes in calcium alginate beads is a popular enzyme immobilization method. However, leaching of immobilized enzymes from the alginate beads is a common problem because enzyme molecules are much smaller than the pore size of alginate beads (∼200nm). To address this issue, we employ a millifluidic reactor to prepare cross-linked cellulase aggregate (XCA) colloids with a uniform size (∼300nm). Subsequently, these colloids are immobilized in calcium alginate beads as biocatalysts to hydrolyze cellulose substrates. By using fluorescent microscopy, we conclude that the immobilized XCA colloids distribute uniformly inside the beads and do not leach out from the beads after long-term incubation. Meanwhile, the pore size of the alginate beads is big enough for the cellulose substrates and fibers to diffuse into the beads for hydrolysis. For example, palm oil fiber and microcrystalline cellulose can be hydrolyzed within 48h and release reducing sugar concentrations up to 2.48±0.08g/l and 4.99±0.09g/l, respectively. Moreover, after 10 cycles of hydrolysis, 96.4% of the XCA colloids remain inside the alginate beads and retain 67% of the original activity. In contrast, free cellulase immobilized in the alginate beads loses its activity completely after 10 cycles. The strategy can also be used to prepare other types of cross-linked enzyme aggregates with high uniformity., (Copyright © 2016 Elsevier B.V. All rights reserved.)

In this study, a fermentation process for production of butanol and butyl-butyrate by using Clostridium sp. strain BOH3 is developed. This strain is able to produce butyric acid and butanol when it ferments 60 g/L xylose. Meanwhile, it also excreted indigenous lipases (induced by olive oil) which naturally convert butyric acid and butanol into 1.2 g/L of butyl-butyrate. When Bio-OSR was used as both an inducer for lipase and extractant for butyl-butyrate, the butyl-butyrate concentration can reach 6.3 g/L. To further increase the yield, additional lipases and butyric acid are added to the fermentation system. Moreover, kerosene was used as an extractant to remove butyl-butyrate in situ. When all strategies are combined, 22.4 g/L butyl-butyrate can be produced in a fed-batch reactor spiked with 70 g/L xylose and 7.9 g/L butyric acid, which is 4.5-fold of that in a similar system (5 g/L) with hexadecane as the extractant., (Copyright © 2015 Elsevier Ltd. All rights reserved.)

Most biobutanol-producing Clostridium strains are unable to ferment polysaccharides such as cellulose and xylan due to the lack of hydrolyzing enzymes. In this study, we show that Clostridium beijerinckii G117, a newly isolated biobutanol-producing strain, expresses xylanase enzyme in the presence of 1% beechwood xylan. The xylanase activity in the medium containing actively growing culture and 1% of beechwood xylan can reach up to 2.66 U/ml after 14 h of fermentation. Using salting-out and size-exclusion chromatography, we purify the crude xylanase by 8.7-fold from the supernatant with a yield of 32.2%. This purified xylanase has a molecular weight of 22.6 kDa, making it one of the smallest reported clostridial xylanases. Conserved domain analysis reveals that the xylanase belongs to glycoside hydrolase family 11 (GH11) but lacks a carbohydrate binding domain. When beechwood xylan is used as substrate for the xylanase, majority of the products are xylo-oligosaccharide (~98%), suggesting that this is an endo-1,4-β-xylanase.

Many cations such as sodium ions have strong influence on anchoring behaviors of liquid crystals (LC). Since DNA is negatively charged and forms complex with metal ions, it is possible to form DNA/metal ions complex on surfaces to disrupt orientations of LC. This phenomenon is used to establish a principle for detecting surface immobilized DNA by using LC. In contrast, peptide nucleic acid (PNA) is electroneutral. It does not complex with metal ions or affect the orientations of LC. Therefore, PNA can be used as a probe to hybridize with specific DNA with a unique sequence, and the principle mentioned above can be used to detect the DNA target by using metal ions and LC. Based on this method, a 600bp DNA target in buffer can be detected with a limit of detection at 10fM. Unlike other fluorescence-based DNA assays, this LC-based detection method does not require labeling of DNA, and the test result can be viewed with the naked eye under a polarized microscope., (Copyright © 2014 Elsevier Inc. All rights reserved.)

Recent advance in liquid crystal (LqC) based immunoassays enables label-free detection of antibody, but manual preparation of LqC cells and injection of LqC are required. In this work, we developed a new format of LqC-based immunoassay which is hosted in a microfluidic device. In this format, the orientations of LqC are strongly influenced by four channel walls surrounding the LqC. When the aspect ratio (depth/width) of the channel is smaller than 0.38, LqC orients homeotropically inside the microchannel and appears dark. After antigens bind to immobilized antibodies on the channel walls, a shift of the LqC appearance from dark to bright (due to the disruption of LqC orientation) can be visualized directly. To streamline the immunoassay process, a tubing cartridge loaded with a sample solution, washing buffers and a plug of LqC is connected to the microfluidic device. By using pressure-driven flow, the cartridge allows antigen/antibody binding, washing and optical detection to be accomplished in a sequential order. We demonstrate that this microfluidic immunoassay is able to detect anti-rabbit IgG with a naked-eye detection limit down to 1 μg mL(-1). This new format of immunoassay provides a simple and robust approach to perform LqC-based label-free immunodetection in microfluidic devices., (Copyright © 2014 Elsevier B.V. All rights reserved.)

In this study, we report immobilization of cysteine-labeled oligopeptides on UV activated surfaces decorated with N,N-dimethyl-n-octadecyl-3-aminopropyltrimethoxysilyl chloride (DMOAP). Our result shows that cysteine group, regardless of its position in the oligopeptide, is essential for successful immobilization of oligopeptide on the UV-activated surface. A possible reaction mechanism is nucleophilic addition of thiolates to surface aldehyde groups generated during UV activation. By using this technique, we are able to incorporate anchoring points into oligopeptides through cysteine residues. Furthermore, immobilized oligopeptides on the UV-activated surface is very stable even under harsh washing conditions. Finally, we show that an HPQ-containing oligopeptide can be immobilized on the UV-activated surface, but the final surface density and its ability to bind streptavidin are affected by the position of cysteine and HPQ. An oligopeptide with a cysteine at the N-terminus and a HPQ motif at the C-terminus gives the highest binding signal in the streptavidin-binding assay. This result is potentially useful for the development of functional oligopeptide microarrays for detecting target protein molecules., (Copyright © 2014 Elsevier B.V. All rights reserved.)

Fastidious anaerobic bacteria play critical roles in environmental bioremediation of halogenated compounds. However, their characterization and application have been largely impeded by difficulties in growing them in pure culture. Thus far, no pure culture has been reported to respire on the notorious polychlorinated biphenyls (PCBs), and functional genes responsible for PCB detoxification remain unknown due to the extremely slow growth of PCB-respiring bacteria. Here we report the successful isolation and characterization of three Dehalococcoides mccartyi strains that respire on commercial PCBs. Using high-throughput metagenomic analysis, combined with traditional culture techniques, tetrachloroethene (PCE) was identified as a feasible alternative to PCBs to isolate PCB-respiring Dehalococcoides from PCB-enriched cultures. With PCE as an alternative electron acceptor, the PCB-respiring Dehalococcoides were boosted to a higher cell density (1.2 × 10(8) to 1.3 × 10(8) cells per mL on PCE vs. 5.9 × 10(6) to 10.4 × 10(6) cells per mL on PCBs) with a shorter culturing time (30 d on PCE vs. 150 d on PCBs). The transcriptomic profiles illustrated that the distinct PCB dechlorination profile of each strain was predominantly mediated by a single, novel reductive dehalogenase (RDase) catalyzing chlorine removal from both PCBs and PCE. The transcription levels of PCB-RDase genes are 5-60 times higher than the genome-wide average. The cultivation of PCB-respiring Dehalococcoides in pure culture and the identification of PCB-RDase genes deepen our understanding of organohalide respiration of PCBs and shed light on in situ PCB bioremediation.

This paper focuses on a novel modified technique about the treatment of adult obstructed megaureter by the transperitoneal laparoscopic procedure. With the improvement of the laparoscopic surgery, many urological surgeries can be safely and effectually performed by laparoscopic approach. The previously reported laparoscopic methods for treatment of adult obstructed megaureter were complex and time-consuming. To simplify the method, we modified the laparoscopic approach based on the previous methods. The innovative points of our novel technique are the extracorporeal tailoring of ureter and nipple ureteroneocystostomy. By this modified procedure, the time of operation can be obviously reduced while the procedure is effective. We hope this modified procedure will be accepted by more urologists.

Hypothesis: Uniform cross-linked cellulase aggregate (XCA) can be prepared by using a millifluidic reactor which consists of two inlets and a Y-junction, because mixing pattern and spatial distribution of reactants can be controlled precisely., Experiments: Aqueous cellulase solution is mixed with acetonitrile (as a precipitant) and 20 mM of glutaraldehyde (as a cross-linker) at the Y-junction. XCA is collected from the outlet of the reactor., Findings: Uniform XCA, with an average size between 200 nm and 400 nm, can be formed inside the reactor. Unlike free cellulase, XCA is insoluble such that it can be filtered out from the solution. It can be used alone or absorb on silica gel (XCA-Si) as a catalyst for hydrolyzing carboxymethyl cellulose (CMC). Interestingly, XCA-Si shows highest activity at pH 4.8 and 50°C, which is similar to the optimal condition of free cellulase. Moreover, XCA-Si is more stable than free cellulase at high temperature (>60°C). It precipitates naturally and can be recycled at least 5 times after the hydrolysis of CMC., (Copyright © 2014 Elsevier Inc. All rights reserved.)

Chlorophenols are widely used as biocides, leading them to being prevalent environmental contaminants that pose toxic threats to ecosystems. In this study, a Dehalobacter species strain TCP1 was isolated from a digester sludge sample, which is able to dechlorinate 2,4,6-trichlorophenol (2,4,6-TCP) to 4-monochlorophenol (4-MCP) with H2 as the sole electron donor and acetate as the carbon source. Strain TCP1 also distinguishes itself from other Dehalobacter species with its capability to dechlorinate tetrachloroethene or trichloroethene (TCE) to both cis- and trans-dichloroethenes in a ratio of 5.6 (±0.2):1. The growth yields of strain TCP1 on TCE and 2,4,6-TCP were 4.14 × 10(13) and 5.77 × 10(13) cells mol(-1) of Cl(-) released, respectively. Strain TCP1 contains five unusually long 16S rRNA gene copies per genome, and the extra length is due to the ~110 bp insertion sequences at their 5'-ends. This suggests that strain TCP1 may represent a novel Dehalobacter species. A putative chlorophenol reductive dehalogenase gene-debcprA-was identified to catalyze the ortho-chlorine removal from 2,4,6-TCP. Both the culture-dependent and housekeeping rpoB gene-based approaches indicate the purity of the culture. Strain TCP1 can serve as a promising candidate for the bioremediation of 2,4,6-TCP contaminated sites, and its discovery expands our understanding of metabolic capabilities of Dehalobacter species.

Clostridium strain BOH3 is able to utilize 10 g/l of xylan in reinforced clostridial medium (RCM) and produce butanol and hydrogen. However, increasing xylan concentration to 30 g/l does not enhance the production of butanol and hydrogen due to insufficient expression of xylanase enzyme (27.5 U/mg). To enhance the xylanase activity, an optimized culture medium (OCM), which consists of sugarcane bagasse hydrolysate (11.75 g/l), ammonium sulfate (8.92 g/l) and iron (III) chloride (1.45 mM) is designed. In the optimized OCM, Clostridium strain BOH3 expresses more xylanase and shows higher xylanase activity (44.05 ± 0.25 U/mg) in the OCM. This activity is about 1.6-fold higher than that in the original RCM. Employing OCM as a medium, Clostridium strain BOH3 effectively ferments high concentration (30 and 50 g/l) of xylan and produces 12.05 ± 0.15 and 14.80 ± 0.15 g/l of butanol and 1.78 ± 0.08 and 2.65 ± 0.15 l/l of hydrogen, respectively., (Copyright © 2013 Elsevier Ltd. All rights reserved.)

Cellulase is an important enzyme for hydrolyzing cellulose to form glucose. To recycle cellulase after the reaction, cellulase is often immobilized on solid supports but its activity is also compromised. In this study, we show a new hybrid cellulase aggregate with a silica core, which is prepared by physical adsorption of cross-linked cellulase on a highly porous solid support silica gel. The hybrid cellulase aggregate exhibits highest activity at pH 4.8 and 51°C, similar to the optimum condition of free cellulase. This hybrid cellulase aggregate can produce 3.4 g/L of glucose within 2 h, which is two times higher than glucose produced by using cross-linked cellulase aggregate alone (without silica core). Another advantage of the hybrid cellulase aggregate is that it can settle down naturally after the hydrolysis of cellulose, thanks to the presence of the silica core. To show its practical applications, we also study the hydrolysis of palm oil fiber by using the hybrid cellulase aggregate. Up to 5.0 g/L of glucose can be produced within 24h, and this process can be repeated five times with only 19% decrease in activity., (Copyright © 2013 Elsevier Inc. All rights reserved.)

Liver regeneration is an angiogenesis-associated phenomenon. The present study investigated the influence of thalidomide, an antiangiogenic agent, on vascular endothelial growth factor (VEGF) expression and liver regeneration after 70% partial hepatectomy (PH) in rats. PH was performed on 50 rats dosed with either thalidomide (100 mg/kg) or a vehicle (controls) by intragastric administration. Serial changes in hepatic microcirculation were evaluated by laser Doppler flowmetry. The VEGF expression in liver tissue was assessed by immunohistochemical study and western blot analysis. Following hepatectomy, the liver regeneration rate increased markedly and reached a peak at 96 h in the two groups. Thalidomide did not affect the overall restoration of liver mass, although a delay in cell proliferation was observed. Prior to PH, the liver microcirculation in rats treated with thalidomide for 2 days was comparatively less than that in their corresponding controls; however, no significant difference between the groups was detected at any time-point following PH. Western blotting showed that the expression of VEGF was upregulated by hepatectomy and the expression levels in the two groups were equal at all studied time-points. The immunohistochemical staining revealed a waved pattern of VEGF expression which advanced from the periportal to pericentral area in both groups, but a slower advancement was detected in thalidomide-treated rats. In conclusion, thalidomide exerted no significant effects on the expression of VEGF and did not impair the overall restoration of liver mass in a rat model of PH-induced liver regeneration, providing supportive evidence for its use as an adjunct treatment modality for liver cancers.

We report a functional protease assay in which liquid crystals (LCs) are used as signal reporters to transduce the test results into optical signals. In this assay, an oligopeptide substrate (CLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK) is used as a probe. This oligopeptide can be cleaved by α-chymotrypsin at multiple locations and become smaller fragments after the cleavage. When the original oligopeptide is immobilized on a solid surface, its long flexible oligopeptide chain is able to influence the orientation of a thin layer of LC supported on the surface, as is evident as a bright spot on the surface. In contrast, when the shorter oligopeptide fragments are immobilized on the same surface, their shorter, less flexible chains cannot disrupt the orientation of LC, and a dark spot is observed. On the basis of the dark or bright signal from LC, α-chymotrypsin in buffer solution or complex media such as chicken broth can be detected by using the naked eye. However, when the incubation time is 3h, the limit of detection (LOD) for α-chymotrypsin in buffer solution is 50 ng/mL, whereas that in chicken broth is only 500 ng/mL. Unlike traditional antibody-based assays which show little difference between active and inactive α-chymotrypsin, only active protease can be detected in this assay. This study shows the potential utility of LCs for detecting functional proteases with good specificity and sensitivity., (Copyright © 2012 Elsevier B.V. All rights reserved.)

In this paper, we report a method of printing uniform protein lines on glass slides by using UV-treated flat PDMS stamps. Unlike traditional microcontact printing (μCP) which requires microstructured PDMS stamps, this μCP method only requires a flat PDMS stamp, an UV lamp and a number of straight needles. Our results show that lines of bovine serum albumin (BSA), immunoglobin (IgG), anti-biotin, anti-human IgG and anti-mouse IgG can be printed evenly on glass slides by using this μCP method. We also demonstrate that the printed protein lines are suitable for applications such as microfluidic immunoassays., (Copyright © 2010 Elsevier Inc. All rights reserved.)

Immunobiosensors are emerging as powerful tools for diagnostic applications. In this paper, we exploit optical properties of liquid crystal (LC) and the specific epitope-antibody interaction to develop an optical immunobiosensor which can be used to detect monoclonal anti-FLAG M2, a model antibody. The sensitive layer of this immunobiosensor is a monolayer of immobilized oligopeptide CDYKDDDDK (FLAG) at an LC/aqueous interface. The linear oligopeptide can function as an epitope which can be recognized by anti-FLAG M2. When the LC is modified with 50 μM of FLAG and then exposed to an aqueous solution containing anti-FLAG, anti-FLAG binds to the immobilized FLAG epitope and triggers orientational transition of LC. Because of the optical birefringence of the LC, the orientational transition is accompanied by changes in the optical images of LC from dark to bright under crossed polarizers. The detection limit for the system is 27 ng/mL of anti-FLAG, and the response time is < 1 h. The binding of anti-FLAG to its motif FLAG oligopeptide is also very specific. When a variant epitope CDAKDDDDK is used, no apparent optical response can be observed after the addition of anti-FLAG., (Copyright 2010 Elsevier B.V. All rights reserved.)

Materials with chemical micropatterned surface have broad applications in many fields. In this article, we report a simple one-step UV lithography method to activate inert hydrocarbon monolayers for spontaneous formation of water and covalently immobilized protein micropatterns on the surface. Two types of hydrocarbon monolayers including octadecyltrichlorosilane (OTS) on silicon oxide and 1-hexadecene on hydrogen-terminated silicon were studied. It was found that after UV modifications, water can form micropatterns spontaneously on both surfaces. Furthermore, when protein solutions were used, covalently immobilized protein micropatterns can be formed. Our XPS results and controlled reducing experiments showed that UV exposure transformed inert monolayers into active surfaces with aldehyde groups, which are responsible for the covalent immobilization of proteins. The method reported herein can be applied under ambient conditions without having a high vacuum system. It can also be extended to pattern other biomolecules bearing amine groups., (Copyright 2009 Elsevier Inc. All rights reserved.)

We report an easily visualized liquid crystal (LC)-based system to study the biophysical interactions between protein-coated gold nanoparticles (AuNPs) and LC-supported cell membrane model. The model consists of mixed phospholipid/cholesterol monolayer self-assembled at aqueous-LC interface. Protein-coated AuNPs were found to disrupt the mixed phospholipid/cholesterol monolayer. As a result, orientational transitions of LCs were triggered and optical responses of LCs from dark to bright were observed. The mixed monolayers with higher cholesterol contents were found to be more susceptible to the disruption by protein-coated AuNPs, and hydrophobic interaction played a major role in the monolayer disruption. We also found that the time for non-specific binding of fibrinogen-coated AuNPs to the mixed phospholipid/cholesterol monolayer was similar to that of specific binding of neutravidin-coated AuNPs to the mixed phospholipid/biotin-capped phospholipid monolayer. Results obtained from this study may offer new understanding in the potential nanotoxicity pathway, where the biophysical interaction between nanomaterials and cell membrane is an important step., (Copyright 2010 Elsevier Ltd. All rights reserved.)

We report a simple method of creating well-defined micropatterns on the surface of a flat PDMS stamp, making it suitable for microcontact printing of proteins. This method only requires a UV lamp (254 nm) and a TEM grid (as a photomask) to modify the surface of PDMS for creating desired micropatterns. By using the UV-modified stamp, a printed protein micropattern that resembles the original TEM grid can be obtained. Surprisingly, unlike the oxygen-plasma-treated PDMS, the UV-modified flat stamp is also long-lasting (>1 week). The method reported herein is very economical for microcontact printing applications because expensive silicon masters and microstructured PDMS are no longer required.

Conventional DNA detection is often accomplished by using UV-vis or fluorescence spectrometry, which requires at least 1 microL of DNA solution. Herein, we report a label-free, liquid-crystal (LC)-based DNA quantification method that is suitable for characterizing DNA solution volumes of <1 microL. The detection principle of this method is based on the disruption of the orientations of LCs by surface-immobilized DNA, which leads to distinct optical textures of LCs visible to the naked eye. However, this method is successful only when the buffer contains divalent cations such as calcium or magnesium. The limit of detection of this method is approximately 4 microg/mL DNA, and only 10 nL of DNA solution is required, which means that as little as 40 pg of DNA can be detected by using this method. This LC-based detection method is also simple to apply and has the potential to be integrated with lab-on-a-chip devices for DNA analysis.

Semiconducting nanowires have the potential to function as highly sensitive and selective sensors for label-free detection of biological and chemical species. In this paper, we describe the preparation and applications of oligopeptide-modified single crystal silicon nanowire (SiNW) arrays as multichannel metal ion sensors. Because these SiNW arrays were fabricated by using a "top-down" process, a very high density of individually addressable SiNW (180 SiNWs grouped into 36 clusters) can be manufactured on a single chip. Furthermore, after two different SiNW clusters are modified with Pb(2+)-selective and Cu(2+)-selective oligopeptide, respectively, concentrations of Pb(2+) and Cu(2+) in aqueous solutions can be detected simultaneously and selectively in two different channels. By using the SiNW arrays, we successfully achieved a detection limit of 1 nM for Pb(2+) and 10 nM for Cu(2+), respectively. These results demonstrate the potential utility of oligopeptide-modified SiNW arrays for highly sensitive and selective chemical and biological sensing applications.

We describe a highly sensitive, substrate-specific, label-free, and multiplexed protease assay which reports proteases activities as an optical bar chart, allowing test results to be easily assessed by laymen with the naked eye. First, an oligopeptide microarray having six rows of immobilized oligopeptides, with well-controlled orientations and concentration gradients, is immersed in a buffer solution containing proteases. Then, a thin layer liquid crystal is supported on the microarray to transduce the oligopeptide cleavage event into an optical bar chart of different colors and lengths. This type of optical bar chart provides very rich information such as protease concentration, incubation time, surface densities of oligopeptides, etc. Both trypsin and chymotrypsin can be detected by using this assay within 3 h. The capability of the multiplexed protease assay opens up possibilities for detecting toxins such as botulinum neurotoxins which are known to cleave proteins and affect the docking and fusing synaptic vesicles.

We report an easily visualized liquid crystal (LC)-based system to study the molecular interactions between protein-coated gold nanoparticles (AuNPs) and supported phospholipid monolayer self-assembled at the aqueous-LC interface. Protein-coated AuNPs were found to disrupt the phospholipid monolayer and resulted in the orientational transitions of LCs that support the phospholipid layer. The disruption of the phospholipid monolayer depends on the type of protein (albumin, neutravidin, and fibrinogen) adsorbing onto nanoparticles. Furthermore, our results suggest that hydrophobic interaction plays a major role in the disruption of the phospholipid layer by protein-coated AuNPs. Results obtained from this study may offer new understanding in the potential cytotoxicity of nanomaterials, where the interaction between nanoparticles and cell membrane is an important step.

In this article, we report a quartz crystal microbalance (QCM)-based detection method which allows the identification and quantification of two neonicotinoid pesticides, imidacloprid and thiacloprid, in aqueous solutions and celery juice. To achieve high selectivity, molecular imprinted monolayers (MIMs), which can either recognize 1 muM of imidacloprid or 1 muM of thiacloprid, are prepared from alkanethiols self-assembled on QCM sensor chips with preadsorbed templates (either imidacloprid or thiacloprid). Our experimental results show that the detection limit can be improved by using alkanethiols having longer hydrocarbon chains. For example, MIMs prepared from hexadecanethiol have dissociation constants 2-5 times smaller than those prepared from octanethiol. To detect two neonicotinoids in vegetable samples simultaneously, we also develop a new type of MIM with two different templates. A single QCM decorated with this MIM can respond to 10 muM of imidacloprid and 10 muM thiacloprid in celery juice in a real-time manner.

In this paper, we report a new label-free method for the imaging of immobilized oligonucleotide probes on DNA microarrays. The imaging principle is based on the disruption of orientations of nematic liquid crystals (LCs), 4-cyano-4'-pentylbiphenyl (5CB), by the immobilized oligonucleotides on a surface. Because LCs are birefringent materials, disruption of their orientations by the immobilized oligonucleotides can manifest as optical signals visible to the naked eye. LC cells with two homeotropic boundary conditions, which align 5CB perpendicularly to both surfaces, were developed to deliver a distinct contrast between a dark background and a bright image caused by the immobilized oligonucleotides. This design also allows the quantification of immobilized oligonucleotide concentrations through the interference colors of LCs. The LC-based imaging method has a good signal-to-noise ratio and a clear distinction between positive and negative results and is nondestructive to the immobilized oligonucleotides. These advantages make it a promising means of assessing the quality of DNA microarrays.

Transforming growth factor-beta1 (TGF-beta1) mediates expression of collagen 1A2 (Col 1A2) gene via a synergistic cooperation between Smad2/Smad3 and Sp1, both act on the Col 1A2 gene promoter. In our previous study, we reported that a retinoic acid derivative obtained from Phellinus linteus (designated PL) antagonizes TGF-beta-induced liver fibrosis through regulation of ROS and calcium influx. In this continuing study we seek further the effect of PL on the Smad signaling pathway. We used a Col 1A2 promoter-luciferase construct to study the action of PL on Smad through TGF-beta. We found that PL decreases the promoter activity of Col 1A2, hinders the translocalization of phosphorylated Smad2/3-Smad 4 complex from cytosol into nucleus and inhibits Sp1 binding activity. These results suggest that PL inhibits TGF-beta1-induced Col 1A2 promoter activity through blocking ROS and calcium influx as well as impeding Sp1 binding and translocalization of pSmad 2/3-Smad4 complex into nucleus.

Transforming growth factor-beta1 (TGF-beta1) mediates the regulation of extracellular matrix via reactive oxygen species (ROS) and calcium influx, both are activators of hepatic stellate cells (HSC) which play a critical role in hepatic fibrogenesis. Hence one can use ROS assay as the main screening tool for molecules that might antagonize the process of liver fibrosis. A retinoic acid derivative isolated from the mycelium of Phellinus linteus that down-regulates ROS generation and calcium influx in HSC-T6 cells was thus obtained in our screening process. The retinoic acid derivative also reverses an early liver fibrosis, as assayed by liver contents of hydroxyproline, alpha-smooth muscle actin (alpha-SMA), and collagen 1A2, in an early liver fibrosis model we established previously where an inducible expression vector containing a TGF-beta gene was hydrodynamically transferred into a testing animal. Retinoic acid derivative thus acts both in vitro and in vivo to prevent liver fibrosis at an early phase.

Protein assays are critical analytical tools performed in various biochemical laboratories to quantify the concentration of proteins. In this study, we report the optical responses of a thin layer of liquid crystals supported on glass slides decorated with proteins and the utility of this phenomenon as a new "all-or-nothing" type of protein assay. It was found that the orientations of liquid crystals are very sensitive to the concentration of protein solution applied to the surface. When the protein concentration exceeds a critical value (IgG 5.0 microg/mL, BSA 6.0 microg/mL, FTIC-anti-biotin 0.40 microg/mL, and FITC-anti-IgG 0.37 microg/mL), the thin layer of liquid crystals gives a very sharp dark-to-bright optical response within a small concentration range. This characteristic is not observed in any traditional protein assays, which are based on the adsorption of UV or visible light. The optical response is also very precise and reproducible. It is not affected by the thickness of the liquid crystal cell or the amount of organosilanes coated on the glass slides. The liquid crystal-based protein assay may be very useful for screening purposes, especially when a simple positive or negative answer is desired.

Background: Liver fibrosis represents a significant and severe health care problem and there are no efficient drugs for therapy so far. Preventing the progression of fibrogenesis and revival endogenous repair activities is an important strategy for both current and future therapies. Many studies of liver fibrosis consist of animal testing with various hepatotoxins. Although this method is often used, the model at which cirrhosis or extensive fibrosis becomes irreversible has not been well defined and is not representative of early-stage fibrogenesis. We here report the establishment of a transient and reversible liver fibrosis animal model which may better represent an early and natural fibrotic event. We used a high-speed intravenous injection of naked plasmid DNA of transforming growth factor-beta1 (TGF-beta1) gene which is under the control of a metallothionein-regulated gene in a pPK9A expression vector into the tail vein (the hydrodynamics-based transfer) and fed the mouse with zinc sulfate (ZnSO4)-containing water simultaneously., Results: Using our hydrodynamics-based gene transfer model we found that upon induction by ZnSO4, the serum TGF-beta1 level in Balb/c mice and Sp1 transcription factor binding activity peaked at 48 h and declined thereafter to a normal level on the 5th day. In addition, mRNA and protein levels of TGF-beta1 in the liver were also upregulated at 48 h. Furthermore, induction of TGF-beta1 increased the alpha-smooth muscle actin (alpha-SMA), p-Smad2/3, hydroxyproline and collagen 1A2 (Col 1A2) levels in the liver, suggesting a significant liver fibrosis., Conclusion: Our results show that TGF-beta1 in pPK9a-transferred mice liver with ZnSO4 feeding can achieve a high expression level with significant fibrosis. However, since TGF-beta1 induction is transient in our model, the fibrotic level does not reach a large scale (panlobular fibrosis) as seen in the CCl4-treated liver. Our model hence represents a dynamic and reversible liver fibrosis and could be a useful tool for studying early molecular mechanism of fibrogenesis or screening of antifibrotic drugs for clinical use.